GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvE in Paraburkholderia bryophila 376MFSha3.1

Align aromatic-amino-acid transaminase TyrB; EC 2.6.1.57 (characterized)
to candidate H281DRAFT_04974 H281DRAFT_04974 aromatic-amino-acid transaminase

Query= CharProtDB::CH_004054
         (397 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_04974 H281DRAFT_04974
           aromatic-amino-acid transaminase
          Length = 399

 Score =  419 bits (1076), Expect = e-122
 Identities = 216/399 (54%), Positives = 278/399 (69%), Gaps = 5/399 (1%)

Query: 1   MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAE-ARLNAQ 59
           +F  V+    DPIL L E F  D R  KVNL +G+Y+NE+G IP L+AV +AE AR+ A 
Sbjct: 3   LFSAVELAPRDPILGLNEAFNADTRPTKVNLGVGVYFNEEGKIPLLRAVRDAEKARVEAA 62

Query: 60  -PHGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRY 118
            P G   YLP+EG+  Y  A+  LL G D P++   RV T Q LGG+GALK+GADFLKR 
Sbjct: 63  LPRG---YLPIEGIAAYDAAVQKLLLGNDSPLIAAGRVVTAQALGGTGALKIGADFLKRL 119

Query: 119 FPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLPARSIVLL 178
            P + V +SDP+WENH A+F  AGFEV +YP+YD  T+GV F+ +L+ L +  A ++V+L
Sbjct: 120 NPSAKVAISDPSWENHRALFEAAGFEVVSYPYYDAHTHGVNFDGMLSALNSYAAGTVVVL 179

Query: 179 HPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLP 238
           H CCHNPTG DLT DQW  ++E++KAR L+PFLDIAYQGFG  +E DA A+R  A++ L 
Sbjct: 180 HACCHNPTGVDLTVDQWKQIVEVVKARNLVPFLDIAYQGFGDNIEADAAAVRLFAASELN 239

Query: 239 ALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAV 298
             VS+SFSK FSLYGER+G LS++    E A RVL QLK  +R NYS+PP  G  VVAAV
Sbjct: 240 VFVSSSFSKSFSLYGERIGALSIITGSKEEATRVLSQLKRVIRTNYSNPPTHGGSVVAAV 299

Query: 299 LNDEALKASWLAEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQ 358
           L    L+A+W  E+  MR RI AMR  LV+ L     +R+F ++  QRGMFSY+GL+A Q
Sbjct: 300 LASPELRATWETELAGMRDRIRAMRNGLVERLKASGVDRDFSFVNAQRGMFSYSGLTAPQ 359

Query: 359 VDRLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM 397
           VDRLREEFG+Y +++GR+CVA LNT N+  VA A A V+
Sbjct: 360 VDRLREEFGIYAVSTGRICVAALNTRNLDVVANAIAHVL 398


Lambda     K      H
   0.320    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 435
Number of extensions: 18
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 397
Length of database: 399
Length adjustment: 31
Effective length of query: 366
Effective length of database: 368
Effective search space:   134688
Effective search space used:   134688
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory