Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate H281DRAFT_00600 H281DRAFT_00600 succinyldiaminopimelate aminotransferase apoenzyme
Query= BRENDA::Q9ZEX3 (397 letters) >lcl|FitnessBrowser__Burk376:H281DRAFT_00600 H281DRAFT_00600 succinyldiaminopimelate aminotransferase apoenzyme Length = 405 Score = 469 bits (1208), Expect = e-137 Identities = 241/403 (59%), Positives = 291/403 (72%), Gaps = 11/403 (2%) Query: 1 MNPRLDALHPYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIAANLAGLS 60 +NP LD+L PYPFEKLRAL D P P I+ IGEPKH P + A+ A+L GLS Sbjct: 1 VNPLLDSLQPYPFEKLRALFKDVA-PAAGFPHISFGIGEPKHPTPTLITDAVIASLGGLS 59 Query: 61 VYPSTKGEPALRQAISQWLSRRYSIPAPDPESEVLPVLGSREALFAFAQTVIDPSAGA-- 118 YP+T G LR++I++W+++RY +P DP ++VLPV GSREALFA AQTVIDP A Sbjct: 60 AYPATVGSLPLRESIAKWVTQRYGLPPVDPATQVLPVSGSREALFALAQTVIDPRRNAKG 119 Query: 119 ---LVVCPNPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSP 175 +V+CPNPFYQIYEGAA+LAGA PY+VN+DPAR+F VP +VW RTQL++VCSP Sbjct: 120 EPAIVLCPNPFYQIYEGAAILAGAEPYFVNSDPARNFACDYSAVPADVWARTQLLYVCSP 179 Query: 176 GNPAGNVMSLEEWRTLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRLGRDRYT 235 GNP G V++LE+WR LF LSDRHGFVIA+ ECYSEIY DE PLG L+AA +LGR Y Sbjct: 180 GNPTGAVLTLEDWRELFALSDRHGFVIASDECYSEIYFDEANAPLGGLEAAHKLGRG-YD 238 Query: 236 NLVAFSSLSKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAWSMRRM 295 L+ SSLSKRSNVPGMRSGFVAGDAA+L FLLYRTYHG+A+S V +ASIAAW+ Sbjct: 239 RLIMLSSLSKRSNVPGMRSGFVAGDAAILKDFLLYRTYHGAALSTVFQSASIAAWNDEAH 298 Query: 296 CRKT-AQYRAKFEAVLPILQNVLDVRAPQASFYLWAG---TPGSDTAFARELYGRTGVTV 351 R+ A+Y KF V P+L VLDVR P A+FYLWA T +DT FA+ LY VTV Sbjct: 299 VRENRAKYVQKFSTVTPMLAAVLDVRLPDAAFYLWADVSRTGLTDTEFAQRLYADYNVTV 358 Query: 352 LPGSLLAREAHNANPGQGRIRIALVAPLDQCVQAAERIAHFAR 394 LPGS LAR AH NPG+ +R+ALVA +D+C Q A+RI F R Sbjct: 359 LPGSFLARTAHGVNPGRNFVRLALVADVDECTQGAQRIVDFCR 401 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 553 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 405 Length adjustment: 31 Effective length of query: 366 Effective length of database: 374 Effective search space: 136884 Effective search space used: 136884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate H281DRAFT_00600 H281DRAFT_00600 (succinyldiaminopimelate aminotransferase apoenzyme)
to HMM TIGR03538 (dapC: succinyldiaminopimelate transaminase (EC 2.6.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03538.hmm # target sequence database: /tmp/gapView.20011.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03538 [M=395] Accession: TIGR03538 Description: DapC_gpp: succinyldiaminopimelate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-186 605.7 0.0 2e-186 605.5 0.0 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_00600 H281DRAFT_00600 succinyldiaminop Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_00600 H281DRAFT_00600 succinyldiaminopimelate aminotransferase apoenzyme # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 605.5 0.0 2e-186 2e-186 1 395 [] 1 400 [. 1 400 [. 0.98 Alignments for each domain: == domain 1 score: 605.5 bits; conditional E-value: 2e-186 TIGR03538 1 mnpnlerlkpyPfeklaellkdvtppadleeialsiGePkhatPafvlealvenleelskyPttkG 66 +np l++l+pyPfekl++l+kdv p+a ++i++ iGePkh+tP+++++a++++l +ls+yP+t G lcl|FitnessBrowser__Burk376:H281DRAFT_00600 1 VNPLLDSLQPYPFEKLRALFKDVAPAAGFPHISFGIGEPKHPTPTLITDAVIASLGGLSAYPATVG 66 599*************************************************************** PP TIGR03538 67 lpelreaiaeWlerrfelpagvdperqvlPvnGtrealfafvqavidrae.....kalvvlPnPfy 127 + lre+ia+W+++r+ lp vdp++qvlPv G+realfa++q+vid+++ a+v++PnPfy lcl|FitnessBrowser__Burk376:H281DRAFT_00600 67 SLPLRESIAKWVTQRYGLPP-VDPATQVLPVSGSREALFALAQTVIDPRRnakgePAIVLCPNPFY 131 ********************.**************************9998888678899****** PP TIGR03538 128 qiyeGaallagaepyflnctaengfkpdfdavpeevWkrvqllfvcsPgnPtGavlsleelkklle 193 qiyeGaa+lagaepyf+n++++ +f d++avp++vW+r+qll+vcsPgnPtGavl+le++++l++ lcl|FitnessBrowser__Burk376:H281DRAFT_00600 132 QIYEGAAILAGAEPYFVNSDPARNFACDYSAVPADVWARTQLLYVCSPGNPTGAVLTLEDWRELFA 197 ****************************************************************** PP TIGR03538 194 ladkydfiiasdecyselyldeaeaPvGlleaaaelGrddfkrllvfhslskrsnvPGlrsGfvaG 259 l+d+++f+iasdecyse+y+dea+aP+G leaa++lGr + rl++++slskrsnvPG+rsGfvaG lcl|FitnessBrowser__Burk376:H281DRAFT_00600 198 LSDRHGFVIASDECYSEIYFDEANAPLGGLEAAHKLGR-GYDRLIMLSSLSKRSNVPGMRSGFVAG 262 *************************************8.8************************** PP TIGR03538 260 daellkeflryrtyhGcampiavqlasiaaWedekhvrenralyrekfaavleilgavldlelPda 325 da++lk+fl yrtyhG+a++ q asiaaW+de+hvrenra+y +kf++v+ +l+avld++lPda lcl|FitnessBrowser__Burk376:H281DRAFT_00600 263 DAAILKDFLLYRTYHGAALSTVFQSASIAAWNDEAHVRENRAKYVQKFSTVTPMLAAVLDVRLPDA 328 ****************************************************************** PP TIGR03538 326 sfylWlkv..pdgddeafaralyeeenvkvlpGrylsreaegvnPGegrvrlalvaeleecveaae 389 +fylW+ v + d++fa++ly++ nv+vlpG++l+r a+gvnPG+++vrlalva+++ec+++a+ lcl|FitnessBrowser__Burk376:H281DRAFT_00600 329 AFYLWADVsrTGLTDTEFAQRLYADYNVTVLPGSFLARTAHGVNPGRNFVRLALVADVDECTQGAQ 394 ******99444579**************************************************** PP TIGR03538 390 rikkll 395 ri +++ lcl|FitnessBrowser__Burk376:H281DRAFT_00600 395 RIVDFC 400 **9985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (395 nodes) Target sequences: 1 (405 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 8.69 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory