Align N-succinyldiaminopimelate-aminotransferase (EC 2.6.1.17) (characterized)
to candidate H281DRAFT_00600 H281DRAFT_00600 succinyldiaminopimelate aminotransferase apoenzyme
Query= metacyc::MONOMER-6501 (397 letters) >FitnessBrowser__Burk376:H281DRAFT_00600 Length = 405 Score = 469 bits (1208), Expect = e-137 Identities = 241/403 (59%), Positives = 291/403 (72%), Gaps = 11/403 (2%) Query: 1 MNPRLDALHPYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIAANLAGLS 60 +NP LD+L PYPFEKLRAL D P P I+ IGEPKH P + A+ A+L GLS Sbjct: 1 VNPLLDSLQPYPFEKLRALFKDVA-PAAGFPHISFGIGEPKHPTPTLITDAVIASLGGLS 59 Query: 61 VYPSTKGEPALRQAISQWLSRRYSIPAPDPESEVLPVLGSREALFAFAQTVIDPSAGA-- 118 YP+T G LR++I++W+++RY +P DP ++VLPV GSREALFA AQTVIDP A Sbjct: 60 AYPATVGSLPLRESIAKWVTQRYGLPPVDPATQVLPVSGSREALFALAQTVIDPRRNAKG 119 Query: 119 ---LVVCPNPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSP 175 +V+CPNPFYQIYEGAA+LAGA PY+VN+DPAR+F VP +VW RTQL++VCSP Sbjct: 120 EPAIVLCPNPFYQIYEGAAILAGAEPYFVNSDPARNFACDYSAVPADVWARTQLLYVCSP 179 Query: 176 GNPAGNVMSLEEWRTLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRLGRDRYT 235 GNP G V++LE+WR LF LSDRHGFVIA+ ECYSEIY DE PLG L+AA +LGR Y Sbjct: 180 GNPTGAVLTLEDWRELFALSDRHGFVIASDECYSEIYFDEANAPLGGLEAAHKLGRG-YD 238 Query: 236 NLVAFSSLSKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAWSMRRM 295 L+ SSLSKRSNVPGMRSGFVAGDAA+L FLLYRTYHG+A+S V +ASIAAW+ Sbjct: 239 RLIMLSSLSKRSNVPGMRSGFVAGDAAILKDFLLYRTYHGAALSTVFQSASIAAWNDEAH 298 Query: 296 CRKT-AQYRAKFEAVLPILQNVLDVRAPQASFYLWAG---TPGSDTAFARELYGRTGVTV 351 R+ A+Y KF V P+L VLDVR P A+FYLWA T +DT FA+ LY VTV Sbjct: 299 VRENRAKYVQKFSTVTPMLAAVLDVRLPDAAFYLWADVSRTGLTDTEFAQRLYADYNVTV 358 Query: 352 LPGSLLAREAHNANPGQGRIRIALVAPLDQCVQAAERIAHFAR 394 LPGS LAR AH NPG+ +R+ALVA +D+C Q A+RI F R Sbjct: 359 LPGSFLARTAHGVNPGRNFVRLALVADVDECTQGAQRIVDFCR 401 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 553 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 405 Length adjustment: 31 Effective length of query: 366 Effective length of database: 374 Effective search space: 136884 Effective search space used: 136884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate H281DRAFT_00600 H281DRAFT_00600 (succinyldiaminopimelate aminotransferase apoenzyme)
to HMM TIGR03538 (dapC: succinyldiaminopimelate transaminase (EC 2.6.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03538.hmm # target sequence database: /tmp/gapView.18188.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03538 [M=395] Accession: TIGR03538 Description: DapC_gpp: succinyldiaminopimelate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-186 605.7 0.0 2e-186 605.5 0.0 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_00600 H281DRAFT_00600 succinyldiaminop Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_00600 H281DRAFT_00600 succinyldiaminopimelate aminotransferase apoenzyme # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 605.5 0.0 2e-186 2e-186 1 395 [] 1 400 [. 1 400 [. 0.98 Alignments for each domain: == domain 1 score: 605.5 bits; conditional E-value: 2e-186 TIGR03538 1 mnpnlerlkpyPfeklaellkdvtppadleeialsiGePkhatPafvlealvenleelskyPttkG 66 +np l++l+pyPfekl++l+kdv p+a ++i++ iGePkh+tP+++++a++++l +ls+yP+t G lcl|FitnessBrowser__Burk376:H281DRAFT_00600 1 VNPLLDSLQPYPFEKLRALFKDVAPAAGFPHISFGIGEPKHPTPTLITDAVIASLGGLSAYPATVG 66 599*************************************************************** PP TIGR03538 67 lpelreaiaeWlerrfelpagvdperqvlPvnGtrealfafvqavidrae.....kalvvlPnPfy 127 + lre+ia+W+++r+ lp vdp++qvlPv G+realfa++q+vid+++ a+v++PnPfy lcl|FitnessBrowser__Burk376:H281DRAFT_00600 67 SLPLRESIAKWVTQRYGLPP-VDPATQVLPVSGSREALFALAQTVIDPRRnakgePAIVLCPNPFY 131 ********************.**************************9998888678899****** PP TIGR03538 128 qiyeGaallagaepyflnctaengfkpdfdavpeevWkrvqllfvcsPgnPtGavlsleelkklle 193 qiyeGaa+lagaepyf+n++++ +f d++avp++vW+r+qll+vcsPgnPtGavl+le++++l++ lcl|FitnessBrowser__Burk376:H281DRAFT_00600 132 QIYEGAAILAGAEPYFVNSDPARNFACDYSAVPADVWARTQLLYVCSPGNPTGAVLTLEDWRELFA 197 ****************************************************************** PP TIGR03538 194 ladkydfiiasdecyselyldeaeaPvGlleaaaelGrddfkrllvfhslskrsnvPGlrsGfvaG 259 l+d+++f+iasdecyse+y+dea+aP+G leaa++lGr + rl++++slskrsnvPG+rsGfvaG lcl|FitnessBrowser__Burk376:H281DRAFT_00600 198 LSDRHGFVIASDECYSEIYFDEANAPLGGLEAAHKLGR-GYDRLIMLSSLSKRSNVPGMRSGFVAG 262 *************************************8.8************************** PP TIGR03538 260 daellkeflryrtyhGcampiavqlasiaaWedekhvrenralyrekfaavleilgavldlelPda 325 da++lk+fl yrtyhG+a++ q asiaaW+de+hvrenra+y +kf++v+ +l+avld++lPda lcl|FitnessBrowser__Burk376:H281DRAFT_00600 263 DAAILKDFLLYRTYHGAALSTVFQSASIAAWNDEAHVRENRAKYVQKFSTVTPMLAAVLDVRLPDA 328 ****************************************************************** PP TIGR03538 326 sfylWlkv..pdgddeafaralyeeenvkvlpGrylsreaegvnPGegrvrlalvaeleecveaae 389 +fylW+ v + d++fa++ly++ nv+vlpG++l+r a+gvnPG+++vrlalva+++ec+++a+ lcl|FitnessBrowser__Burk376:H281DRAFT_00600 329 AFYLWADVsrTGLTDTEFAQRLYADYNVTVLPGSFLARTAHGVNPGRNFVRLALVADVDECTQGAQ 394 ******99444579**************************************************** PP TIGR03538 390 rikkll 395 ri +++ lcl|FitnessBrowser__Burk376:H281DRAFT_00600 395 RIVDFC 400 **9985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (395 nodes) Target sequences: 1 (405 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.26 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory