GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapC in Paraburkholderia bryophila 376MFSha3.1

Align phosphoserine aminotransferase; EC 2.6.1.52 (characterized)
to candidate H281DRAFT_03926 H281DRAFT_03926 phosphoserine aminotransferase apoenzyme

Query= CharProtDB::CH_002572
         (362 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_03926 H281DRAFT_03926
           phosphoserine aminotransferase apoenzyme
          Length = 360

 Score =  399 bits (1026), Expect = e-116
 Identities = 195/358 (54%), Positives = 264/358 (73%), Gaps = 1/358 (0%)

Query: 3   QIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLN 62
           ++FNFS+GPA +P EVL+QA  E+ DW G G SVME+SHRGKEF+ + EEA  D R+LL 
Sbjct: 2   RVFNFSAGPAAMPEEVLRQAADEMLDWQGSGMSVMEMSHRGKEFMSIHEEALLDLRELLA 61

Query: 63  VPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAK 122
           VP+++++LF  GGG G+ A VP+N+LG K  AD+V  G W+  ++KEA+KY T +V  + 
Sbjct: 62  VPASHRILFLQGGGLGENAIVPMNLLGWKPRADFVVTGSWSQKSLKEAQKYGTVHVAASG 121

Query: 123 VTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTILSR 182
            T DG        EWQ+SD+ AY+H C NETI G+   E PD G +V + AD SS ILSR
Sbjct: 122 ETADGFTRAPAFSEWQMSDDPAYVHLCTNETIHGVETFEIPDLG-NVPLVADASSHILSR 180

Query: 183 PIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNTPP 242
           P+D+++YGV++ GAQKNIG AG+T+VIVRED+L +A   CPS  ++  + +N SM+NTPP
Sbjct: 181 PMDIAKYGVLFGGAQKNIGMAGVTVVIVREDMLDRAQAICPSAFEWKTVAENNSMYNTPP 240

Query: 243 TFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKANRSRMNVPF 302
           T+A Y++GLVFKWLK  GG+A ++  N +K++LLY  ID+S FY N V +++RSRMNVPF
Sbjct: 241 TYAIYIAGLVFKWLKKQGGLAAIEARNLEKSKLLYDTIDSSSFYLNKVERSSRSRMNVPF 300

Query: 303 QLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEFERR 360
            LAD + ++ FL  + A G+  LKGH+ VGGMRASIYNA+PLEGVKAL ++M EFE+R
Sbjct: 301 FLADESRNEEFLAGAKARGMVQLKGHKSVGGMRASIYNAVPLEGVKALVEYMKEFEQR 358


Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 385
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 362
Length of database: 360
Length adjustment: 29
Effective length of query: 333
Effective length of database: 331
Effective search space:   110223
Effective search space used:   110223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate H281DRAFT_03926 H281DRAFT_03926 (phosphoserine aminotransferase apoenzyme)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01364.hmm
# target sequence database:        /tmp/gapView.15732.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01364  [M=358]
Accession:   TIGR01364
Description: serC_1: phosphoserine transaminase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
   2.7e-159  515.7   0.0   3.1e-159  515.6   0.0    1.0  1  lcl|FitnessBrowser__Burk376:H281DRAFT_03926  H281DRAFT_03926 phosphoserine am


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Burk376:H281DRAFT_03926  H281DRAFT_03926 phosphoserine aminotransferase apoenzyme
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  515.6   0.0  3.1e-159  3.1e-159       1     357 [.       3     358 ..       3     359 .. 0.98

  Alignments for each domain:
  == domain 1  score: 515.6 bits;  conditional E-value: 3.1e-159
                                    TIGR01364   1 ivnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyev 66 
                                                  ++nFsaGPaa+peevl++a++e+ld++g+g+svme+sHR kef++++eea  dlreLl +p ++++
  lcl|FitnessBrowser__Burk376:H281DRAFT_03926   3 VFNFSAGPAAMPEEVLRQAADEMLDWQGSGMSVMEMSHRGKEFMSIHEEALLDLRELLAVPASHRI 68 
                                                  58**************************************************************** PP

                                    TIGR01364  67 lflqGGattqfaavplnllkekkvadyivtGawskkalkeakkltkevkvvase.eekkyskipde 131
                                                  lflqGG+ ++ a vp+nll  k  ad++vtG+ws+k+lkea+k+++ v+v+as    + +++ p  
  lcl|FitnessBrowser__Burk376:H281DRAFT_03926  69 LFLQGGGLGENAIVPMNLLGWKPRADFVVTGSWSQKSLKEAQKYGT-VHVAASGeTADGFTRAPAF 133
                                                  ********************************************99.888888856789******* PP

                                    TIGR01364 132 eelelkedaayvylcanetieGvefkelpevkkaplvaDlssdilsrkidvskygliyaGaqKniG 197
                                                  +e+++++d ayv+lc+neti+Gve  e+p+  ++plvaD ss+ilsr++d++kyg++++GaqKniG
  lcl|FitnessBrowser__Burk376:H281DRAFT_03926 134 SEWQMSDDPAYVHLCTNETIHGVETFEIPDLGNVPLVADASSHILSRPMDIAKYGVLFGGAQKNIG 199
                                                  ****************************************************************** PP

                                    TIGR01364 198 paGvtvvivrkdllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekGGvkklek 263
                                                  +aGvtvvivr+d+l+ra++++ps +++k++aen+s+yntppt+aiy++glv+kwlk++GG++++e+
  lcl|FitnessBrowser__Burk376:H281DRAFT_03926 200 MAGVTVVIVREDMLDRAQAICPSAFEWKTVAENNSMYNTPPTYAIYIAGLVFKWLKKQGGLAAIEA 265
                                                  ****************************************************************** PP

                                    TIGR01364 264 knqeKakllYeaidesegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvslkGhrsvG 329
                                                  +n eK+kllY++id+s+ fy nkve+++Rs+mnv+F l++e  ++eFl+ a+++g+v+lkGh+svG
  lcl|FitnessBrowser__Burk376:H281DRAFT_03926 266 RNLEKSKLLYDTIDSSS-FYLNKVERSSRSRMNVPFFLADESRNEEFLAGAKARGMVQLKGHKSVG 330
                                                  **************886.************************************************ PP

                                    TIGR01364 330 GiRasiYnalpleevqaLvdfmkeFekk 357
                                                  G+RasiYna+ple+v+aLv++mkeFe++
  lcl|FitnessBrowser__Burk376:H281DRAFT_03926 331 GMRASIYNAVPLEGVKALVEYMKEFEQR 358
                                                  *************************986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (358 nodes)
Target sequences:                          1  (360 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.91
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory