Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate H281DRAFT_05606 H281DRAFT_05606 diaminopimelate decarboxylase
Query= BRENDA::Q9KVL7 (417 letters) >FitnessBrowser__Burk376:H281DRAFT_05606 Length = 420 Score = 476 bits (1225), Expect = e-139 Identities = 242/417 (58%), Positives = 303/417 (72%), Gaps = 6/417 (1%) Query: 2 DYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAVK 61 DY N G L E V LA Q+GTPLYVYSRA L W+A+ + + AVK Sbjct: 7 DYVN----GVLHVEGVSAVSLAEQFGTPLYVYSRAALTDAWNAYAGACAGRRASVHVAVK 62 Query: 62 ANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKIK 121 ANSNL VLN ARLG+GFDIVS GEL RVLAAGG VFSGVGK +EM+ AL +K Sbjct: 63 ANSNLAVLNVFARLGAGFDIVSGGELARVLAAGGKAENTVFSGVGKHASEMREALAAGVK 122 Query: 122 CFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAAQ 181 CFNVES PEL RLN VA E+G AP+SLR+NPDVDAKTHPYISTGL+ NKFG+ F+ A Sbjct: 123 CFNVESIPELDRLNTVAAEMGKIAPVSLRVNPDVDAKTHPYISTGLKSNKFGVAFEDARA 182 Query: 182 VYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGGL 241 Y+ A ++ NL+V GIDCHIGSQ+T +AP++DA D+LL L++ ++ +GI IRH+DVGGGL Sbjct: 183 TYQAAAAMANLEVVGIDCHIGSQITEIAPYLDAVDKLLELVELIEKDGIAIRHIDVGGGL 242 Query: 242 GVVYRDELPPQPSEYAKALLDRLER--HRDLELIFEPGRAIAANAGVLVTKVEFLKHTEH 299 G+ Y DE PP E+ + +LDR+E H E+ FEPGR++ NAGVL+T+VEFLK Sbjct: 243 GITYDDETPPDIGEFVRTVLDRIEARGHGHREVYFEPGRSLVGNAGVLLTRVEFLKPGAE 302 Query: 300 KNFAIIDAAMNDLIRPALYQAWQDIIPLRPRQGEAQTYDLVGPVCETSDFLGKDRDLVLQ 359 KNFAI+DAAM +L RPA+Y+A+ I + R A YD+VGPVCE+ D+LG++R L ++ Sbjct: 303 KNFAIVDAAMTELARPAMYEAYHAIDAVVERDVPAHVYDIVGPVCESGDWLGRERLLSVE 362 Query: 360 EGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESVLP 416 GDLL +RS+GAYGF MSSNYNTRPR AEVMVDG + ++VR REE+ L+A E+VLP Sbjct: 363 PGDLLVIRSAGAYGFVMSSNYNTRPRAAEVMVDGTQAHVVRAREEIQQLFAGETVLP 419 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 420 Length adjustment: 32 Effective length of query: 385 Effective length of database: 388 Effective search space: 149380 Effective search space used: 149380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate H281DRAFT_05606 H281DRAFT_05606 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.14975.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-159 516.9 0.1 1.9e-159 516.6 0.1 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_05606 H281DRAFT_05606 diaminopimelate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_05606 H281DRAFT_05606 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 516.6 0.1 1.9e-159 1.9e-159 6 416 .. 10 415 .. 6 416 .. 0.98 Alignments for each domain: == domain 1 score: 516.6 bits; conditional E-value: 1.9e-159 TIGR01048 6 dgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllae 71 +g l +egv++ +lae+fgtPlYvy++++l+ +++a++ a +++++ v+ AvKAnsnlavl+++a+ lcl|FitnessBrowser__Burk376:H281DRAFT_05606 10 NGVLHVEGVSAVSLAEQFGTPLYVYSRAALTDAWNAYAGACAGRRASVHVAVKANSNLAVLNVFAR 75 7899***************************************999******************** PP TIGR01048 72 eGlgldvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiake 137 +G+g+d+vsgGEl+r+laAg kae+ vfsg+gk +e+++al++++k++nv+s+ el++l+++a+e lcl|FitnessBrowser__Burk376:H281DRAFT_05606 76 LGAGFDIVSGGELARVLAAGGKAENTVFSGVGKHASEMREALAAGVKCFNVESIPELDRLNTVAAE 141 ****************************************************************** PP TIGR01048 138 lgkkarvllRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqil 203 +gk a+v+lRvnpdvdakth+yisTGlk++KFG+++e+a+++y++a+++++le+vGi++HIGSqi+ lcl|FitnessBrowser__Burk376:H281DRAFT_05606 142 MGKIAPVSLRVNPDVDAKTHPYISTGLKSNKFGVAFEDARATYQAAAAMANLEVVGIDCHIGSQIT 207 ****************************************************************** PP TIGR01048 204 dlepfveaaekvvklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekeaelg 269 +++p+ +a++k+++l+e ++++gi ++++d+GGGlgi+y++e+ +pd+ e+++++l+++e + g lcl|FitnessBrowser__Burk376:H281DRAFT_05606 208 EIAPYLDAVDKLLELVELIEKDGIAIRHIDVGGGLGITYDDET-PPDIGEFVRTVLDRIEAR---G 269 *****************************************99.************999994...6 PP TIGR01048 270 l.klklilEpGRslvanagvlltrVesvKevesrkfvlvDagmndliRpalYeayheiaalkrlee 334 + + ++ +EpGRslv+nagvlltrVe++K +++f++vDa+m++l Rpa+Yeayh i a+ ++ lcl|FitnessBrowser__Burk376:H281DRAFT_05606 270 HgHREVYFEPGRSLVGNAGVLLTRVEFLKPGAEKNFAIVDAAMTELARPAMYEAYHAIDAVV-ERD 334 6699*******************************************************995.599 PP TIGR01048 335 eetetvdvvGplCEsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlveegka 400 +++++d+vGp+CEsgD l+++r l +ve+Gdll+++saGAYg+ mssnYn+rpr+aev+v++ +a lcl|FitnessBrowser__Burk376:H281DRAFT_05606 335 VPAHVYDIVGPVCESGDWLGRERLL-SVEPGDLLVIRSAGAYGFVMSSNYNTRPRAAEVMVDGTQA 399 99*******************9966.6999************************************ PP TIGR01048 401 rlirrretledllale 416 +++r re++++l+a e lcl|FitnessBrowser__Burk376:H281DRAFT_05606 400 HVVRAREEIQQLFAGE 415 ************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (420 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.84 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory