Align Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 (characterized)
to candidate H281DRAFT_00859 H281DRAFT_00859 cystathionine beta-lyase
Query= SwissProt::P9WGB7 (388 letters) >FitnessBrowser__Burk376:H281DRAFT_00859 Length = 394 Score = 165 bits (418), Expect = 2e-45 Identities = 117/384 (30%), Positives = 181/384 (47%), Gaps = 17/384 (4%) Query: 16 TRAIHAGYRPDPATGAVNVPIYASSTFAQDGVGGLRG-------GFEYARTGNPTRAALE 68 TR +HA + P + ++P+ +ST + +R + Y PT AL Sbjct: 12 TRIVHAEDKLTPGFESFSMPVTRASTVVFPDLATMRALDWKNDAQWRYGLHATPTSLALA 71 Query: 69 ASLAAVEEGAFARAFSSGMAATDCALRAMLRPGDHVVIPDDAYGGTFRLIDKVFTRWDVQ 128 LA +E G A SG+++ +++ GD V+IPD+ Y D + + V Sbjct: 72 QRLATIEGGNHALLQPSGLSSISNVYFGLVKAGDDVLIPDNVYSPNRDHGDWLARDFGVT 131 Query: 129 ---YTPVRLADLDAVGAAITPRTRLIWVETPTNPLLSIADITAIAELGTDRSAKVLVDNT 185 Y P+ A + I P TRLIW+E P + + +AD+ AI R+ +DNT Sbjct: 132 VRYYDPMIGA---GIAELIQPNTRLIWLEAPGSVTMEVADVPAITAAARARNVVTAIDNT 188 Query: 186 FASPALQQPLRLGADVVLHSTTKYIGGHSDVVGGALVTNDEELDEEFAFLQNGAGAVPGP 245 +++ +P G D+ + + TKY G DV+ GA +T D EL + + G Sbjct: 189 WSAGLGFRPFDHGVDISVQALTKYQSGGGDVLMGATITVDRELHLKLKAARMRMGIGVSS 248 Query: 246 FDAYLTMRGLKTLVLRMQRHSENACAVAEFLADHPSVSSVLYPGLPSHPGHEIAARQMRG 305 D L +R L T+ +R Q+H +A A+A++L P +++VL+P + PGHE R G Sbjct: 249 DDCSLILRSLPTMQVRFQQHDRSALALAQWLKTRPEIAAVLHPAIEDCPGHEFFKRDFTG 308 Query: 306 FGGMVSVRMRAGRRAAQ--DLCAKTRVFILAESLGGVESLIEHPSAMTHASTAGSQLEVP 363 GG+ SV AAQ C +F + S GG SL+ P + T G + Sbjct: 309 AGGLFSVVFDGRYSAAQIDTFCESLELFAIGWSWGGAHSLV-MPYDIASMRTEG-EWPHR 366 Query: 364 DDLVRLSVGIEDIADLLGDLEQAL 387 LVR +G+E+ ADL D+EQ L Sbjct: 367 GTLVRFYIGLEEEADLRADIEQCL 390 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 394 Length adjustment: 31 Effective length of query: 357 Effective length of database: 363 Effective search space: 129591 Effective search space used: 129591 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory