GapMind for Amino acid biosynthesis

 

Aligments for a candidate for argC in Paraburkholderia bryophila 376MFSha3.1

Align N-acetyl-gamma-glutamyl-phosphate reductase; AGPR; EC 1.2.1.38; N-acetyl-glutamate semialdehyde dehydrogenase; NAGSA dehydrogenase (uncharacterized)
to candidate H281DRAFT_02654 H281DRAFT_02654 N-acetyl-gamma-glutamyl-phosphate reductase

Query= curated2:B1K264
         (313 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_02654 H281DRAFT_02654
           N-acetyl-gamma-glutamyl-phosphate reductase
          Length = 309

 Score =  442 bits (1136), Expect = e-129
 Identities = 224/307 (72%), Positives = 246/307 (80%), Gaps = 1/307 (0%)

Query: 1   MSFPTVFIDGDQGTTGLQIHARLRDRTDVRLLTLPAAERKDAARRADALNACDIAILCLP 60
           MS P +FIDGDQGTTGLQIH RLR+RTD+ + TL AAERKDA  RA+A+NACDIAILCLP
Sbjct: 1   MSAPVIFIDGDQGTTGLQIHERLRNRTDITVFTLAAAERKDARLRAEAINACDIAILCLP 60

Query: 61  DAAAREAVGFIRNPAVRVIDASSAHRTQPDWVYGFPEMADGHAHDIAHAKRVTNPGCYPT 120
           DAAAREAV  I NPAVRVIDASSAHRTQ  W YGFPEM  G    IA A+RVTNPGCYPT
Sbjct: 61  DAAAREAVNAIVNPAVRVIDASSAHRTQTGWTYGFPEMTSGQRERIASARRVTNPGCYPT 120

Query: 121 GAIGLLRPLLQAGLLPRDYPVSIHAVSGYSGGGRAAVDAFESGDAAARALPLQVYGLALE 180
           GAIGLLRPLLQAGL+P +YP+SIHAVSGYSG GRA V+  E  D A  A   QVYGL L 
Sbjct: 121 GAIGLLRPLLQAGLIPDNYPISIHAVSGYSGRGRAGVEEHEGPD-AINAPSFQVYGLDLA 179

Query: 181 HKHVPEIRQHAGLAHRPFFVPAYGAYRQGIVLTIPIELRLLPAGVTGERLHACLAHHYAD 240
           HKH PEI+QHA LA RP FVPAYGA+RQGIVLT+P++LRLL  GV G  LH CLA HYA+
Sbjct: 180 HKHTPEIQQHALLAQRPIFVPAYGAFRQGIVLTVPLQLRLLAPGVDGATLHTCLARHYAE 239

Query: 241 ARHVDVMPLADAAAATHLDPQALNGTNDLRLGVLVNADGGQVLLSAVFDNLGKGASGAAV 300
           A HV V+PL ++ A  HLDPQ LNGTND+RL V    D G VLLSAVFDNLGKGASGAAV
Sbjct: 240 AAHVRVVPLHESCAEKHLDPQVLNGTNDMRLSVFPAVDHGHVLLSAVFDNLGKGASGAAV 299

Query: 301 QNLDLML 307
           QNL+LML
Sbjct: 300 QNLNLML 306


Lambda     K      H
   0.322    0.138    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 368
Number of extensions: 13
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 313
Length of database: 309
Length adjustment: 27
Effective length of query: 286
Effective length of database: 282
Effective search space:    80652
Effective search space used:    80652
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

Align candidate H281DRAFT_02654 H281DRAFT_02654 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01851 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01851.hmm
# target sequence database:        /tmp/gapView.24241.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01851  [M=310]
Accession:   TIGR01851
Description: argC_other: N-acetyl-gamma-glutamyl-phosphate reductase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
   3.8e-121  390.1   0.0   4.2e-121  390.0   0.0    1.0  1  lcl|FitnessBrowser__Burk376:H281DRAFT_02654  H281DRAFT_02654 N-acetyl-gamma-g


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Burk376:H281DRAFT_02654  H281DRAFT_02654 N-acetyl-gamma-glutamyl-phosphate reductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  390.0   0.0  4.2e-121  4.2e-121       2     308 ..       4     306 ..       3     308 .. 0.98

  Alignments for each domain:
  == domain 1  score: 390.0 bits;  conditional E-value: 4.2e-121
                                    TIGR01851   2 pkvfidGeaGttGlqirerlaerddlellsidedkrkdaderakllnaadvailclpddaareavs 67 
                                                  p +fidG++GttGlqi+erl +r+d+ + ++++  rkda  ra+ +na d+ailclpd aareav 
  lcl|FitnessBrowser__Burk376:H281DRAFT_02654   4 PVIFIDGDQGTTGLQIHERLRNRTDITVFTLAAAERKDARLRAEAINACDIAILCLPDAAAREAVN 69 
                                                  78**************************************************************** PP

                                    TIGR01851  68 lvdnpntkildastayrtaedwvyGfpelaaeqrekianakrvanPGcyatgaiallrPlveaGil 133
                                                   + np+++++das+a+rt+ +w+yGfpe++++qre+ia+a+rv+nPGcy+tgai llrPl++aG++
  lcl|FitnessBrowser__Burk376:H281DRAFT_02654  70 AIVNPAVRVIDASSAHRTQTGWTYGFPEMTSGQRERIASARRVTNPGCYPTGAIGLLRPLLQAGLI 135
                                                  ****************************************************************** PP

                                    TIGR01851 134 PadfPvtinavsGysGGGkaliakyeeesaddskkaafiiyglalehkhlpemrkhsglaskPift 199
                                                  P ++P++i+avsGysG G+a ++++e   a   +  +f++ygl l hkh pe+++h+ la++Pif+
  lcl|FitnessBrowser__Burk376:H281DRAFT_02654 136 PDNYPISIHAVSGYSGRGRAGVEEHEGPDA--INAPSFQVYGLDLAHKHTPEIQQHALLAQRPIFV 199
                                                  **************************5544..44589***************************** PP

                                    TIGR01851 200 PavGdfaqGllveiplhlaeldskvsaedihkalaeyykGekfvkvaelddaellddtildaqgln 265
                                                  Pa G f qG+++++pl+l  l+  v ++ +h  la +y+  ++v+v++l+++    ++ ld+q ln
  lcl|FitnessBrowser__Burk376:H281DRAFT_02654 200 PAYGAFRQGIVLTVPLQLRLLAPGVDGATLHTCLARHYAEAAHVRVVPLHESC--AEKHLDPQVLN 263
                                                  **************************************************998..679******** PP

                                    TIGR01851 266 gtnrlelfvfgsddgerallvarldnlGkGasGaavqnlnial 308
                                                  gtn + l vf++ d +++ll a +dnlGkGasGaavqnln++l
  lcl|FitnessBrowser__Burk376:H281DRAFT_02654 264 GTNDMRLSVFPAVDHGHVLLSAVFDNLGKGASGAAVQNLNLML 306
                                                  ******************************************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (310 nodes)
Target sequences:                          1  (309 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 6.42
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory