Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate H281DRAFT_06264 H281DRAFT_06264 glutamate 5-kinase
Query= BRENDA::P0A7B5 (367 letters) >FitnessBrowser__Burk376:H281DRAFT_06264 Length = 372 Score = 290 bits (741), Expect = 6e-83 Identities = 160/366 (43%), Positives = 224/366 (61%), Gaps = 1/366 (0%) Query: 1 MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL 60 ++DS+ LVVK+G+S++T R L+ A I Q A L A +V+V+SGAIA G + L Sbjct: 5 IADSRRLVVKVGSSLVTNDGRGLDHAAIGRWAAQIAALRAQSKEVVLVSSGAIAEGMQRL 64 Query: 61 GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT 120 G+ + P I Q AAVGQ L Q++E F+ + I Q+LLT AD+ DRER+LNAR T Sbjct: 65 GWSKRPREIDELQAAAAVGQMGLAQVYESRFAEHSIQTAQILLTHADLADRERYLNARST 124 Query: 121 LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPR 180 L LL +VP+INEND V T EIK GDND L AL A L D L++LTDQ+GL+TADPR Sbjct: 125 LLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEGDALIILTDQQGLFTADPR 184 Query: 181 SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPG 240 +P A L++ L A+AG + S LG GGM TK+ AA A +G +T+IA+G + Sbjct: 185 KDPNATLVQQADAGAPDLEAMAGGAGSSLGRGGMLTKILAAKRAAHSGANTVIASGREAD 244 Query: 241 VIGDVMEGISVGTLFHAQATPLENRKRWIFG-APPAGEITVDEGATAAILERGSSLLPKG 299 V+ + G ++GT A+ + RK+W+ G + +D+GA + G SLLP G Sbjct: 245 VLSRLASGEAIGTQLIARTARMAARKQWMADHLQVRGHVVIDDGAVEKLTAGGKSLLPIG 304 Query: 300 IKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAV 359 I V G F+RGEVI N GR++A G++ Y+S + I S EI+++LGY P + Sbjct: 305 IVGVQGAFARGEVIACLNAAGREVARGLTNYSSAETKLIQRRPSGEIESVLGYMLEPELI 364 Query: 360 HRDDMI 365 HRD+++ Sbjct: 365 HRDNLV 370 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 372 Length adjustment: 30 Effective length of query: 337 Effective length of database: 342 Effective search space: 115254 Effective search space used: 115254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate H281DRAFT_06264 H281DRAFT_06264 (glutamate 5-kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.22830.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-133 428.9 3.4 9.5e-133 428.7 3.4 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_06264 H281DRAFT_06264 glutamate 5-kina Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_06264 H281DRAFT_06264 glutamate 5-kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 428.7 3.4 9.5e-133 9.5e-133 1 362 [. 9 370 .. 9 371 .. 0.99 Alignments for each domain: == domain 1 score: 428.7 bits; conditional E-value: 9.5e-133 TIGR01027 1 kriVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkkla 66 +r+VvK+Gss++t++ + l+++ + + ++q+a+l+++ +evv+vsSGa+a G+++Lg ++rp+++ lcl|FitnessBrowser__Burk376:H281DRAFT_06264 9 RRLVVKVGSSLVTNDGRGLDHAAIGRWAAQIAALRAQSKEVVLVSSGAIAEGMQRLGWSKRPREID 74 589*************************************************************** PP TIGR01027 67 ekQalaaVGQgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNEN 132 e Qa+aaVGQ L + ye+ f+++++++aQiLLt+adl++rerylNar+tl +ll lgvvpi+NEN lcl|FitnessBrowser__Burk376:H281DRAFT_06264 75 ELQAAAAVGQMGLAQVYESRFAEHSIQTAQILLTHADLADRERYLNARSTLLTLLRLGVVPIINEN 140 ****************************************************************** PP TIGR01027 133 DtvaveeikfGDNDtLsalvaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkava 198 Dtv ++eikfGDNDtL alva+l+e d+L++ltd++gL++adpr++p+A+l+++ ++ + +l+a+a lcl|FitnessBrowser__Burk376:H281DRAFT_06264 141 DTVVTDEIKFGDNDTLGALVANLIEGDALIILTDQQGLFTADPRKDPNATLVQQADAGAPDLEAMA 206 ****************************************************************** PP TIGR01027 199 gssgssvGTGGmrtKleaaelAsragveviiasgekpekiadlledaavgtlfeakkkklknrkqw 264 g++gss+G GGm tK+ aa+ A+++g +++iasg++ + + +l++++a+gt++ a+++++ +rkqw lcl|FitnessBrowser__Burk376:H281DRAFT_06264 207 GGAGSSLGRGGMLTKILAAKRAAHSGANTVIASGREADVLSRLASGEAIGTQLIARTARMAARKQW 272 ****************************************************************** PP TIGR01027 265 ilaaseakGkiivdegaeeallekgksLlpagvvevegnFsrgevveilaeegqeigkglvnysse 330 ++ +++ +G++++d+ga+e+l++ gksLlp g+v+v+g F rgev+ +l+ +g+e+++gl+nyss+ lcl|FitnessBrowser__Burk376:H281DRAFT_06264 273 MADHLQVRGHVVIDDGAVEKLTAGGKSLLPIGIVGVQGAFARGEVIACLNAAGREVARGLTNYSSA 338 ****************************************************************** PP TIGR01027 331 elekikglkseeiedvLgyekkeevvhrdnlv 362 e + i++++s eie vLgy + e +hrdnlv lcl|FitnessBrowser__Burk376:H281DRAFT_06264 339 ETKLIQRRPSGEIESVLGYMLEPELIHRDNLV 370 ******************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (372 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.06 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory