GapMind for Amino acid biosynthesis

 

Aligments for a candidate for tyrB in Paraburkholderia bryophila 376MFSha3.1

Align Aromatic-amino-acid aminotransferase (EC 2.6.1.57) (characterized)
to candidate H281DRAFT_04974 H281DRAFT_04974 aromatic-amino-acid transaminase

Query= reanno::Cup4G11:RR42_RS33490
         (400 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_04974 H281DRAFT_04974
           aromatic-amino-acid transaminase
          Length = 399

 Score =  426 bits (1096), Expect = e-124
 Identities = 215/396 (54%), Positives = 271/396 (68%)

Query: 1   MFEHIDAYPGDPILSLNESFQLDPRTDKVNLSIGIYFDDEGRLPVMQAVREAEAALMADM 60
           +F  ++  P DPIL LNE+F  D R  KVNL +G+YF++EG++P+++AVR+AE A +   
Sbjct: 3   LFSAVELAPRDPILGLNEAFNADTRPTKVNLGVGVYFNEEGKIPLLRAVRDAEKARVEAA 62

Query: 61  GPRPYLPMAGFAAYRDAVQALVFGQPCQARAEGRIATVQTLGGSGALRVGADFLKRYFPD 120
            PR YLP+ G AAY  AVQ L+ G      A GR+ T Q LGG+GAL++GADFLKR  P 
Sbjct: 63  LPRGYLPIEGIAAYDAAVQKLLLGNDSPLIAAGRVVTAQALGGTGALKIGADFLKRLNPS 122

Query: 121 AQVWISDPSWENHRVIFERTGFTVNTYPYYDDATGGLKFDAMLDALRLIPKRSIVLLHAC 180
           A+V ISDPSWENHR +FE  GF V +YPYYD  T G+ FD ML AL      ++V+LHAC
Sbjct: 123 AKVAISDPSWENHRALFEAAGFEVVSYPYYDAHTHGVNFDGMLSALNSYAAGTVVVLHAC 182

Query: 181 CHNPTGVDLNHDQWRQLITLLKQHELLPFVDMAYQGFGAGLDDDAFAVRELVAQGVPCLV 240
           CHNPTGVDL  DQW+Q++ ++K   L+PF+D+AYQGFG  ++ DA AVR   A  +   V
Sbjct: 183 CHNPTGVDLTVDQWKQIVEVVKARNLVPFLDIAYQGFGDNIEADAAAVRLFAASELNVFV 242

Query: 241 ANSFSKNFSLYGERCGGLSVVCDSAEETGRVLGQLTGAVRANYSNPPTHGARVVARVLTT 300
           ++SFSK+FSLYGER G LS++  S EE  RVL QL   +R NYSNPPTHG  VVA VL +
Sbjct: 243 SSSFSKSFSLYGERIGALSIITGSKEEATRVLSQLKRVIRTNYSNPPTHGGSVVAAVLAS 302

Query: 301 PALRTIWERELAGKCERIAKMRAAIHKGLAAHVSGEALSRYLTQRGMFTYTGLTADQVDR 360
           P LR  WE ELAG  +RI  MR  + + L A       S    QRGMF+Y+GLTA QVDR
Sbjct: 303 PELRATWETELAGMRDRIRAMRNGLVERLKASGVDRDFSFVNAQRGMFSYSGLTAPQVDR 362

Query: 361 LRTEHGVYLLRSGRMCVAGLNERNVTQVAQAIASVL 396
           LR E G+Y + +GR+CVA LN RN+  VA AIA VL
Sbjct: 363 LREEFGIYAVSTGRICVAALNTRNLDVVANAIAHVL 398


Lambda     K      H
   0.323    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 412
Number of extensions: 10
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 399
Length adjustment: 31
Effective length of query: 369
Effective length of database: 368
Effective search space:   135792
Effective search space used:   135792
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory