Align Fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 (characterized)
to candidate CCNA_03360 CCNA_03360 tagatose-1,6-bisphosphate aldolase
Query= SwissProt::Q8YNK2 (359 letters) >FitnessBrowser__Caulo:CCNA_03360 Length = 363 Score = 491 bits (1264), Expect = e-143 Identities = 241/357 (67%), Positives = 294/357 (82%) Query: 1 MALVPLRLLLDHAAENGYGIPAFNVNNLEQIQAILKAAAETDSPVILQASRGARNYAGEN 60 MA + LR LLDHAAE+ YG+PAFN+NN+EQ AI++AA +SPVI+QASRGARNYA + Sbjct: 1 MARITLRQLLDHAAEHEYGLPAFNINNMEQGLAIMEAADAVNSPVIIQASRGARNYANDI 60 Query: 61 FLRHLILAAVETYPEIPIVMHQDHGNAPSTCYSAIKNNFTSVMMDGSLEADAKTPASFEY 120 L +I A V+ YP IP+ MHQDHGN P+TC +AI+ FTSVMMDGSL DAKTPAS+EY Sbjct: 61 MLAKMIDALVDIYPHIPVCMHQDHGNGPATCATAIQYGFTSVMMDGSLMEDAKTPASYEY 120 Query: 121 NVNVTREVVNVAHALGVSVEGELGCLGSLETGAGEAEDGHGFEGTLDHSQLLTDPDEAVN 180 NV VTR+VV +AH+ GVSVEGELG LGSLETG GEAEDGHGFEG L H +LLTDPD+AV+ Sbjct: 121 NVEVTRKVVQMAHSCGVSVEGELGVLGSLETGMGEAEDGHGFEGKLSHDELLTDPDQAVD 180 Query: 181 FVEATQVDALAVAIGTSHGAYKFTRKPTGEILAISRIEEIHRRLPNTHLVMHGSSSVPED 240 FV T VDALA+A+GTSHGAYKFTRKP G++LA++ IEEIHRRLPNTHLVMHGSSSVP+D Sbjct: 181 FVAQTGVDALAIAMGTSHGAYKFTRKPDGDVLAMNVIEEIHRRLPNTHLVMHGSSSVPQD 240 Query: 241 LIALINEYGGAIPETYGVPVEEIQKGIKSGVRKVNIDTDNRLAITAAVREALAKNPKEFD 300 L +IN+YGG +P+T+GVPVEEIQ+GIK GVRK+N+DTDNR+AIT A+R+ L + P EFD Sbjct: 241 LQDIINQYGGEMPQTWGVPVEEIQRGIKHGVRKINVDTDNRMAITGAIRKLLVEKPGEFD 300 Query: 301 PRHFLKPSITYMQKVCAERYVQFGTAGNASKIKQVSLETFAAKYAKGELNAISKAAA 357 PR +LKP+ M+KVC R+V+FG+AG+A KIK +S T A +YA GEL+A A+A Sbjct: 301 PRAYLKPAKEAMRKVCQARFVEFGSAGHADKIKPMSTATMAKRYASGELHAKFGASA 357 Lambda K H 0.315 0.132 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 488 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 363 Length adjustment: 29 Effective length of query: 330 Effective length of database: 334 Effective search space: 110220 Effective search space used: 110220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate CCNA_03360 CCNA_03360 (tagatose-1,6-bisphosphate aldolase)
to HMM TIGR01521 (fba: fructose-bisphosphate aldolase, class II, Calvin cycle subtype (EC 4.1.2.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01521.hmm # target sequence database: /tmp/gapView.952.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01521 [M=347] Accession: TIGR01521 Description: FruBisAldo_II_B: fructose-bisphosphate aldolase, class II, Calvin cycle subtype Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-192 625.7 0.9 1.2e-192 625.5 0.9 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_03360 CCNA_03360 tagatose-1,6-bisphosp Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_03360 CCNA_03360 tagatose-1,6-bisphosphate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 625.5 0.9 1.2e-192 1.2e-192 1 347 [] 3 349 .. 3 349 .. 1.00 Alignments for each domain: == domain 1 score: 625.5 bits; conditional E-value: 1.2e-192 TIGR01521 1 lislrqlldhaaergygvpafnvnnleqilaimeaadktdspvilqasrgarsyagevllrklvlaaveeypd 73 +i+lrqlldhaae+ yg+pafn+nn+eq laimeaad+ +spvi+qasrgar+ya++ +l+k++ a+v+ yp+ lcl|FitnessBrowser__Caulo:CCNA_03360 3 RITLRQLLDHAAEHEYGLPAFNINNMEQGLAIMEAADAVNSPVIIQASRGARNYANDIMLAKMIDALVDIYPH 75 69*********************************************************************** PP TIGR01521 74 ipvvlhqdhgnspatclsaiqlgftsvmmdgslkedaktpadydynvsvtaevvklahavgasvegelgclgs 146 ipv++hqdhgn patc +aiq gftsvmmdgsl edaktpa+y+ynv+vt +vv++ah++g+svegelg lgs lcl|FitnessBrowser__Caulo:CCNA_03360 76 IPVCMHQDHGNGPATCATAIQYGFTSVMMDGSLMEDAKTPASYEYNVEVTRKVVQMAHSCGVSVEGELGVLGS 148 ************************************************************************* PP TIGR01521 147 letgkgeaedghgfegaldrsqlltdpeeaaefvkktkvdalavaigtshgaykftrkptgevlaidrieeih 219 letg+geaedghgfeg+l + +lltdp++a++fv++t+vdala+a+gtshgaykftrkp g+vla+++ieeih lcl|FitnessBrowser__Caulo:CCNA_03360 149 LETGMGEAEDGHGFEGKLSHDELLTDPDQAVDFVAQTGVDALAIAMGTSHGAYKFTRKPDGDVLAMNVIEEIH 221 ************************************************************************* PP TIGR01521 220 erlpdthlvmhgsssvpqewldvineyggeiketygvpveeivkgikfgvrkvnidtdlrlaataalrrvaak 292 +rlp+thlvmhgsssvpq+ +d+in+ygge+++t+gvpveei++gik+gvrk+n+dtd+r+a+t+a+r+++ + lcl|FitnessBrowser__Caulo:CCNA_03360 222 RRLPNTHLVMHGSSSVPQDLQDIINQYGGEMPQTWGVPVEEIQRGIKHGVRKINVDTDNRMAITGAIRKLLVE 294 ************************************************************************* PP TIGR01521 293 dpsefdprkflkkaveamkdvckaryeafgtagnaskikvvsleemarryakgel 347 +p efdpr +lk+a eam++vc+ar+ +fg+ag a kik++s ma+rya+gel lcl|FitnessBrowser__Caulo:CCNA_03360 295 KPGEFDPRAYLKPAKEAMRKVCQARFVEFGSAGHADKIKPMSTATMAKRYASGEL 349 *****************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (347 nodes) Target sequences: 1 (363 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.74 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory