Align aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) (characterized)
to candidate CCNA_03599 CCNA_03599 aspartate-semialdehyde dehydrogenase
Query= BRENDA::P9WNX5 (345 letters) >FitnessBrowser__Caulo:CCNA_03599 Length = 348 Score = 373 bits (958), Expect = e-108 Identities = 208/338 (61%), Positives = 242/338 (71%), Gaps = 6/338 (1%) Query: 5 IGIVGATGQVGQVMRTLLDERDFPASAVRFFASARSQGRKLAFRGQEIEVEDAETADPSG 64 +G+VGATG VG +MR LL ERDFP +++R FASARS G K+ F GQ+I VEDA TAD SG Sbjct: 13 VGVVGATGLVGGMMRELLVERDFPVASLRLFASARSAGGKIDFNGQQIVVEDAATADFSG 72 Query: 65 LDIALFSAGSAMSKVQAPRFAAAGVTVIDNSSAWRKDPDVPLVVSEVNFERDAHRRPKGI 124 LDI FSAG + S+ AP+ AAAG VIDNSSAWR DP+VPLVV+EVN PKGI Sbjct: 73 LDIVFFSAGGSTSRELAPKAAAAGAVVIDNSSAWRSDPEVPLVVAEVN-PHALQNIPKGI 131 Query: 125 IANPNCTTMAAMPVLKVLHDEARLVRLVVSSYQAVSGSGLAGVAELAEQARA-VIGGAEQ 183 +ANPNCTTMAAMPVLK LHD+A L RL VS+YQA SG G+ G+ L+EQ RA G + Sbjct: 132 VANPNCTTMAAMPVLKPLHDKAGLKRLTVSTYQAASGGGMEGIEVLSEQLRAGAAGDLDG 191 Query: 184 LVYDGGALEFPPPNTYVAPIAFNVVPLAGSLVDDGSGETDEDQKLRFESRKILGIPDLLV 243 L A P P + P+A+NVVPL L +D G T+E+ KLR ESRKIL IP L V Sbjct: 192 LARSPDAAPLPAPRKWAVPLAYNVVPLNYVLGED--GYTEEELKLRDESRKILEIPGLPV 249 Query: 244 SGTCVRVPVFTGHSLSINAEFAQPLSPERARELLDGATGVQLVDVPTPLAAAGVDESLVG 303 SGTCVRVPVFTGH+LSINAEF P+S A +LL A GV + DVP PLAA G D VG Sbjct: 250 SGTCVRVPVFTGHALSINAEFDGPVSVAEALDLLAAAPGVVIDDVPNPLAATGQDPVFVG 309 Query: 304 RIRRDPGVPDGRGLALFVSGDNLRKGAALNTIQIAELL 341 R+R DP VP GLALFV GDNLRKGAALN +QIAE++ Sbjct: 310 RVRPDPTVP--HGLALFVVGDNLRKGAALNAVQIAEVM 345 Lambda K H 0.317 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 348 Length adjustment: 29 Effective length of query: 316 Effective length of database: 319 Effective search space: 100804 Effective search space used: 100804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate CCNA_03599 CCNA_03599 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.3597.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-128 413.7 0.0 3.4e-128 413.5 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_03599 CCNA_03599 aspartate-semialdehyd Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_03599 CCNA_03599 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 413.5 0.0 3.4e-128 3.4e-128 1 336 [. 12 345 .. 12 347 .. 0.96 Alignments for each domain: == domain 1 score: 413.5 bits; conditional E-value: 3.4e-128 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsaGgsv 73 +v++vGatG vG ++++L er+fp+ +l+l+as+rsaG k+ f+g+++ ve+a +++f+g+di +fsaGgs+ lcl|FitnessBrowser__Caulo:CCNA_03599 12 HVGVVGATGLVGGMMRELLVERDFPVASLRLFASARSAGGKIDFNGQQIVVEDAATADFSGLDIVFFSAGGST 84 69*********************************************************************** PP TIGR01296 74 skefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkplkdeaklk 146 s+e+apkaa+ag++viDn+sa+r d++vPLvv+evn + l++ + kgi+anPnC+t+++++vLkpl+d+a+lk lcl|FitnessBrowser__Caulo:CCNA_03599 85 SRELAPKAAAAGAVVIDNSSAWRSDPEVPLVVAEVNPHALQNIP-KGIVANPNCTTMAAMPVLKPLHDKAGLK 156 *******************************************9.**************************** PP TIGR01296 147 rvvvstYqavsGaGkkgveeLknqtkav....legkekepeida.lkakkfakqiafnaiplidklkedGytk 214 r+ vstYqa sG G +g+e L +q++a l+g ++p + + + k+a ++a+n++pl l edGyt+ lcl|FitnessBrowser__Caulo:CCNA_03599 157 RLTVSTYQAASGGGMEGIEVLSEQLRAGaagdLDGLARSPDAAPlPAPRKWAVPLAYNVVPLNYVLGEDGYTE 229 **************************97112244556666666458899************************ PP TIGR01296 215 eelkllfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvviddpsenlypt 287 eelkl+ e+rkil+i+ l+vs+tcvrvPvftgh++s+++ef+ ++sv e+ +lL apgvv+ d+p lcl|FitnessBrowser__Caulo:CCNA_03599 230 EELKLRDESRKILEIPGLPVSGTCVRVPVFTGHALSINAEFDGPVSVAEALDLLAAAPGVVIDDVP------N 296 ************************************************************999999......8 PP TIGR01296 288 PleavgkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaell 336 Pl+a+g+d vfvgr+r D + +glalfvv+DnlrkGaalnavqiae + lcl|FitnessBrowser__Caulo:CCNA_03599 297 PLAATGQDPVFVGRVRPDPTVPHGLALFVVGDNLRKGAALNAVQIAEVM 345 **********************************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (348 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.52 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory