Align aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) (characterized)
to candidate CCNA_03599 CCNA_03599 aspartate-semialdehyde dehydrogenase
Query= BRENDA::P9WNX5 (345 letters) >lcl|FitnessBrowser__Caulo:CCNA_03599 CCNA_03599 aspartate-semialdehyde dehydrogenase Length = 348 Score = 373 bits (958), Expect = e-108 Identities = 208/338 (61%), Positives = 242/338 (71%), Gaps = 6/338 (1%) Query: 5 IGIVGATGQVGQVMRTLLDERDFPASAVRFFASARSQGRKLAFRGQEIEVEDAETADPSG 64 +G+VGATG VG +MR LL ERDFP +++R FASARS G K+ F GQ+I VEDA TAD SG Sbjct: 13 VGVVGATGLVGGMMRELLVERDFPVASLRLFASARSAGGKIDFNGQQIVVEDAATADFSG 72 Query: 65 LDIALFSAGSAMSKVQAPRFAAAGVTVIDNSSAWRKDPDVPLVVSEVNFERDAHRRPKGI 124 LDI FSAG + S+ AP+ AAAG VIDNSSAWR DP+VPLVV+EVN PKGI Sbjct: 73 LDIVFFSAGGSTSRELAPKAAAAGAVVIDNSSAWRSDPEVPLVVAEVN-PHALQNIPKGI 131 Query: 125 IANPNCTTMAAMPVLKVLHDEARLVRLVVSSYQAVSGSGLAGVAELAEQARA-VIGGAEQ 183 +ANPNCTTMAAMPVLK LHD+A L RL VS+YQA SG G+ G+ L+EQ RA G + Sbjct: 132 VANPNCTTMAAMPVLKPLHDKAGLKRLTVSTYQAASGGGMEGIEVLSEQLRAGAAGDLDG 191 Query: 184 LVYDGGALEFPPPNTYVAPIAFNVVPLAGSLVDDGSGETDEDQKLRFESRKILGIPDLLV 243 L A P P + P+A+NVVPL L +D G T+E+ KLR ESRKIL IP L V Sbjct: 192 LARSPDAAPLPAPRKWAVPLAYNVVPLNYVLGED--GYTEEELKLRDESRKILEIPGLPV 249 Query: 244 SGTCVRVPVFTGHSLSINAEFAQPLSPERARELLDGATGVQLVDVPTPLAAAGVDESLVG 303 SGTCVRVPVFTGH+LSINAEF P+S A +LL A GV + DVP PLAA G D VG Sbjct: 250 SGTCVRVPVFTGHALSINAEFDGPVSVAEALDLLAAAPGVVIDDVPNPLAATGQDPVFVG 309 Query: 304 RIRRDPGVPDGRGLALFVSGDNLRKGAALNTIQIAELL 341 R+R DP VP GLALFV GDNLRKGAALN +QIAE++ Sbjct: 310 RVRPDPTVP--HGLALFVVGDNLRKGAALNAVQIAEVM 345 Lambda K H 0.317 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 348 Length adjustment: 29 Effective length of query: 316 Effective length of database: 319 Effective search space: 100804 Effective search space used: 100804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate CCNA_03599 CCNA_03599 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.6778.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-128 413.7 0.0 3.4e-128 413.5 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_03599 CCNA_03599 aspartate-semialdehyd Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_03599 CCNA_03599 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 413.5 0.0 3.4e-128 3.4e-128 1 336 [. 12 345 .. 12 347 .. 0.96 Alignments for each domain: == domain 1 score: 413.5 bits; conditional E-value: 3.4e-128 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsaGgsv 73 +v++vGatG vG ++++L er+fp+ +l+l+as+rsaG k+ f+g+++ ve+a +++f+g+di +fsaGgs+ lcl|FitnessBrowser__Caulo:CCNA_03599 12 HVGVVGATGLVGGMMRELLVERDFPVASLRLFASARSAGGKIDFNGQQIVVEDAATADFSGLDIVFFSAGGST 84 69*********************************************************************** PP TIGR01296 74 skefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkplkdeaklk 146 s+e+apkaa+ag++viDn+sa+r d++vPLvv+evn + l++ + kgi+anPnC+t+++++vLkpl+d+a+lk lcl|FitnessBrowser__Caulo:CCNA_03599 85 SRELAPKAAAAGAVVIDNSSAWRSDPEVPLVVAEVNPHALQNIP-KGIVANPNCTTMAAMPVLKPLHDKAGLK 156 *******************************************9.**************************** PP TIGR01296 147 rvvvstYqavsGaGkkgveeLknqtkav....legkekepeida.lkakkfakqiafnaiplidklkedGytk 214 r+ vstYqa sG G +g+e L +q++a l+g ++p + + + k+a ++a+n++pl l edGyt+ lcl|FitnessBrowser__Caulo:CCNA_03599 157 RLTVSTYQAASGGGMEGIEVLSEQLRAGaagdLDGLARSPDAAPlPAPRKWAVPLAYNVVPLNYVLGEDGYTE 229 **************************97112244556666666458899************************ PP TIGR01296 215 eelkllfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvviddpsenlypt 287 eelkl+ e+rkil+i+ l+vs+tcvrvPvftgh++s+++ef+ ++sv e+ +lL apgvv+ d+p lcl|FitnessBrowser__Caulo:CCNA_03599 230 EELKLRDESRKILEIPGLPVSGTCVRVPVFTGHALSINAEFDGPVSVAEALDLLAAAPGVVIDDVP------N 296 ************************************************************999999......8 PP TIGR01296 288 PleavgkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaell 336 Pl+a+g+d vfvgr+r D + +glalfvv+DnlrkGaalnavqiae + lcl|FitnessBrowser__Caulo:CCNA_03599 297 PLAATGQDPVFVGRVRPDPTVPHGLALFVVGDNLRKGAALNAVQIAEVM 345 **********************************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (348 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.89 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory