Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate CCNA_01253 CCNA_01253 dihydrodipicolinate synthase
Query= BRENDA::Q8UGL3 (294 letters) >FitnessBrowser__Caulo:CCNA_01253 Length = 294 Score = 321 bits (823), Expect = 1e-92 Identities = 165/291 (56%), Positives = 217/291 (74%), Gaps = 3/291 (1%) Query: 2 FKGSIPALITPFTDNGSVDEKAFAAHVEWQIAEGSNGLVPVGTTGESPTLSHDEHKRVVE 61 FKG IPAL+TPF D G VDEKAF A VE QIA G +GLVPVGTTGE+ TLSH+EH+RVVE Sbjct: 6 FKGVIPALVTPFRD-GEVDEKAFVALVERQIAGGVHGLVPVGTTGETSTLSHEEHRRVVE 64 Query: 62 LCIEVAAKRVPVIAGAGSNNTDEAIELALHAQEAGADALLVVTPYYNKPTQKGLFAHFSA 121 LC++ A RVPVIAGAGSN+TDEAIELA HA+ GADA LVVTPYYN+P+Q+G++ H+ A Sbjct: 65 LCVKTTAGRVPVIAGAGSNSTDEAIELARHAKTVGADACLVVTPYYNRPSQEGMYQHYKA 124 Query: 122 VAEAVKLPIVIYNIPPRSVVDMSPETMGALVKAHKNIIGVKDATGKLDRVSEQRISCGKD 181 + +AV+LPI +YN+P R+ VD+S +T+ L K NI+G+KDATG L R+S QR+ CG + Sbjct: 125 INDAVELPIFVYNVPGRTGVDISNDTLERLAKL-PNIVGIKDATGDLTRISFQRLMCGPE 183 Query: 182 FVQLSGEDGTALGFNAHGGVGCISVTANVAPRLCSEFQAAMLAGDYAKALEYQDRLMPLH 241 +V LSG+D TALG+ AHGG G ISVT+NVAP CS F A + G++ K L +QDRL+ LH Sbjct: 184 WVMLSGDDPTALGYMAHGGHGVISVTSNVAPDACSAFMNACMQGEWEKGLYWQDRLVRLH 243 Query: 242 RAIFMEPGVCGTKYALSKTRGGNRRVRSPLMSTLEPATEAAIDAALKHAGL 292 +A+F++ TK+A+++ VR P+ + E A ++ A++ AGL Sbjct: 244 KALFLDSSPAPTKFAMAQLGLCTEDVRLPITACAEGVRPAILE-AMREAGL 293 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 294 Length adjustment: 26 Effective length of query: 268 Effective length of database: 268 Effective search space: 71824 Effective search space used: 71824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate CCNA_01253 CCNA_01253 (dihydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.20389.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-102 328.8 0.0 1.2e-102 328.6 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_01253 CCNA_01253 dihydrodipicolinate s Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_01253 CCNA_01253 dihydrodipicolinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 328.6 0.0 1.2e-102 1.2e-102 1 283 [. 8 288 .. 8 291 .. 0.98 Alignments for each domain: == domain 1 score: 328.6 bits; conditional E-value: 1.2e-102 TIGR00674 1 gvltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvpviaG 73 gv++Al+TPf++ + vd +a+ l+e+qi+ gv ++v+vGtTGE+ tLs+eE+ +v+e+ v+++++rvpviaG lcl|FitnessBrowser__Caulo:CCNA_01253 8 GVIPALVTPFRDGE-VDEKAFVALVERQIAGGVHGLVPVGTTGETSTLSHEEHRRVVELCVKTTAGRVPVIAG 79 689*******9877.********************************************************** PP TIGR00674 74 tgsnateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgvslepetvk 146 +gsn+t+eaiel+++a+ +g+d++lvvtPyYn+P+qeG+y+h+kai ++velPi +YnvP+Rtgv+++ +t+ lcl|FitnessBrowser__Caulo:CCNA_01253 80 AGSNSTDEAIELARHAKTVGADACLVVTPYYNRPSQEGMYQHYKAINDAVELPIFVYNVPGRTGVDISNDTLE 152 ************************************************************************* PP TIGR00674 147 rLaeeveivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnvapkelkemvkaal 219 rLa+ ++iv+iK+a+gdl+r+s + + + + ++lsGdD ++l +a G++GviSV+snvap+ ++ +++a + lcl|FitnessBrowser__Caulo:CCNA_01253 153 RLAKLPNIVGIKDATGDLTRISFQRLMCGPEWVMLSGDDPTALGYMAHGGHGVISVTSNVAPDACSAFMNACM 225 ************************************************************************* PP TIGR00674 220 egdteeareihqkllklfkalfietNPipvKtalallgliekdelRlPLtelseekkeklkevl 283 +g+ e+ + + +l++l+kalf+++ P p K a+a lgl+++ ++RlP+t+ e + + e++ lcl|FitnessBrowser__Caulo:CCNA_01253 226 QGEWEKGLYWQDRLVRLHKALFLDSSPAPTKFAMAQLGLCTE-DVRLPITACAEGVRPAILEAM 288 ******************************************.9*******9998887776655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (294 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.41 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory