Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate CCNA_01253 CCNA_01253 dihydrodipicolinate synthase
Query= BRENDA::Q8UGL3 (294 letters) >lcl|FitnessBrowser__Caulo:CCNA_01253 CCNA_01253 dihydrodipicolinate synthase Length = 294 Score = 321 bits (823), Expect = 1e-92 Identities = 165/291 (56%), Positives = 217/291 (74%), Gaps = 3/291 (1%) Query: 2 FKGSIPALITPFTDNGSVDEKAFAAHVEWQIAEGSNGLVPVGTTGESPTLSHDEHKRVVE 61 FKG IPAL+TPF D G VDEKAF A VE QIA G +GLVPVGTTGE+ TLSH+EH+RVVE Sbjct: 6 FKGVIPALVTPFRD-GEVDEKAFVALVERQIAGGVHGLVPVGTTGETSTLSHEEHRRVVE 64 Query: 62 LCIEVAAKRVPVIAGAGSNNTDEAIELALHAQEAGADALLVVTPYYNKPTQKGLFAHFSA 121 LC++ A RVPVIAGAGSN+TDEAIELA HA+ GADA LVVTPYYN+P+Q+G++ H+ A Sbjct: 65 LCVKTTAGRVPVIAGAGSNSTDEAIELARHAKTVGADACLVVTPYYNRPSQEGMYQHYKA 124 Query: 122 VAEAVKLPIVIYNIPPRSVVDMSPETMGALVKAHKNIIGVKDATGKLDRVSEQRISCGKD 181 + +AV+LPI +YN+P R+ VD+S +T+ L K NI+G+KDATG L R+S QR+ CG + Sbjct: 125 INDAVELPIFVYNVPGRTGVDISNDTLERLAKL-PNIVGIKDATGDLTRISFQRLMCGPE 183 Query: 182 FVQLSGEDGTALGFNAHGGVGCISVTANVAPRLCSEFQAAMLAGDYAKALEYQDRLMPLH 241 +V LSG+D TALG+ AHGG G ISVT+NVAP CS F A + G++ K L +QDRL+ LH Sbjct: 184 WVMLSGDDPTALGYMAHGGHGVISVTSNVAPDACSAFMNACMQGEWEKGLYWQDRLVRLH 243 Query: 242 RAIFMEPGVCGTKYALSKTRGGNRRVRSPLMSTLEPATEAAIDAALKHAGL 292 +A+F++ TK+A+++ VR P+ + E A ++ A++ AGL Sbjct: 244 KALFLDSSPAPTKFAMAQLGLCTEDVRLPITACAEGVRPAILE-AMREAGL 293 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 294 Length adjustment: 26 Effective length of query: 268 Effective length of database: 268 Effective search space: 71824 Effective search space used: 71824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate CCNA_01253 CCNA_01253 (dihydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.26485.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-102 328.8 0.0 1.2e-102 328.6 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_01253 CCNA_01253 dihydrodipicolinate s Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_01253 CCNA_01253 dihydrodipicolinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 328.6 0.0 1.2e-102 1.2e-102 1 283 [. 8 288 .. 8 291 .. 0.98 Alignments for each domain: == domain 1 score: 328.6 bits; conditional E-value: 1.2e-102 TIGR00674 1 gvltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvpviaG 73 gv++Al+TPf++ + vd +a+ l+e+qi+ gv ++v+vGtTGE+ tLs+eE+ +v+e+ v+++++rvpviaG lcl|FitnessBrowser__Caulo:CCNA_01253 8 GVIPALVTPFRDGE-VDEKAFVALVERQIAGGVHGLVPVGTTGETSTLSHEEHRRVVELCVKTTAGRVPVIAG 79 689*******9877.********************************************************** PP TIGR00674 74 tgsnateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgvslepetvk 146 +gsn+t+eaiel+++a+ +g+d++lvvtPyYn+P+qeG+y+h+kai ++velPi +YnvP+Rtgv+++ +t+ lcl|FitnessBrowser__Caulo:CCNA_01253 80 AGSNSTDEAIELARHAKTVGADACLVVTPYYNRPSQEGMYQHYKAINDAVELPIFVYNVPGRTGVDISNDTLE 152 ************************************************************************* PP TIGR00674 147 rLaeeveivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnvapkelkemvkaal 219 rLa+ ++iv+iK+a+gdl+r+s + + + + ++lsGdD ++l +a G++GviSV+snvap+ ++ +++a + lcl|FitnessBrowser__Caulo:CCNA_01253 153 RLAKLPNIVGIKDATGDLTRISFQRLMCGPEWVMLSGDDPTALGYMAHGGHGVISVTSNVAPDACSAFMNACM 225 ************************************************************************* PP TIGR00674 220 egdteeareihqkllklfkalfietNPipvKtalallgliekdelRlPLtelseekkeklkevl 283 +g+ e+ + + +l++l+kalf+++ P p K a+a lgl+++ ++RlP+t+ e + + e++ lcl|FitnessBrowser__Caulo:CCNA_01253 226 QGEWEKGLYWQDRLVRLHKALFLDSSPAPTKFAMAQLGLCTE-DVRLPITACAEGVRPAILEAM 288 ******************************************.9*******9998887776655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (294 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.33 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory