Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate CCNA_03323 CCNA_03323 phosphoserine aminotransferase
Query= BRENDA::P52878 (370 letters) >lcl|FitnessBrowser__Caulo:CCNA_03323 CCNA_03323 phosphoserine aminotransferase Length = 396 Score = 459 bits (1180), Expect = e-134 Identities = 229/383 (59%), Positives = 275/383 (71%), Gaps = 15/383 (3%) Query: 2 KPTRVPNNPCFSSGPCAKHPGYSIEELKDTPFGRSHRSNLGKEKLAEAIKKTRDMLGLPD 61 KP P P FSSGPCAK PG++ E L++ GRSHRS LGK +L AI +TR++L +P Sbjct: 7 KPAIRPARPEFSSGPCAKRPGWTPENLRNAVLGRSHRSKLGKARLKAAIDQTREVLEVPA 66 Query: 62 DYLVGIVPASDTGAFEMCLWSMLGCRGVDVLVWESFSKGWATDITKQLKLKDVRVFEAEY 121 D+L+GIV SDTGA EM +WSMLG R V +L +ESF K W TD+TKQLKL DV V A Y Sbjct: 67 DFLIGIVAGSDTGAVEMAMWSMLGARPVQLLAFESFGKDWVTDVTKQLKLPDVEVLSAPY 126 Query: 122 GKLPDLKKVDFKNDVVFVWNGTTSGVKVPNGDWIPENREGLTLCDATSAIFAMDIPYHKL 181 G+LPD KVD D+VF WNGTTSGV+VPN D+I +REG+T+CDATSA FA D+ + KL Sbjct: 127 GQLPDTSKVDPAKDLVFTWNGTTSGVRVPNADFISADREGITICDATSAAFAQDLDWTKL 186 Query: 182 DVITFSWQKVLGGEGAHGMLILSPRAVQRLESYTPAWPLPKIFRLTK-----GGKLNKKI 236 DV+TFSWQK LGGEGAHG+LILSPRAV RLESYTPAWP+PK+FR+TK G K++ I Sbjct: 187 DVVTFSWQKALGGEGAHGVLILSPRAVARLESYTPAWPMPKLFRMTKANKDGGNKVSLDI 246 Query: 237 FEGSTINTPSMLANEDWLATLKWAESVGGLKPLIQRTNDNLAVFEAFVAKNNWIHFLAET 296 FEG+TINTPSML ED L LKWA S+GGL+ + R + NL V +VAK W+ FLA T Sbjct: 247 FEGATINTPSMLCVEDALDALKWASSIGGLQAMQARADQNLKVLADWVAKTPWVDFLAAT 306 Query: 297 KEIRSSTSVCFKV----------DLSDEKLKELIKTLEKEKVAYDIGSYRDAPSGLRIWC 346 EIRS+TSVC KV D + K+L LEKE A DIG YRDAP+GLRIWC Sbjct: 307 PEIRSNTSVCLKVVDPAICALPEDAQADFAKKLASLLEKEGAALDIGGYRDAPAGLRIWC 366 Query: 347 GATVEKEDLQCLCEWIEWAYNLV 369 GATVE DL+ L W++WA+ V Sbjct: 367 GATVEASDLEALTPWLDWAFATV 389 Lambda K H 0.318 0.136 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 485 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 396 Length adjustment: 30 Effective length of query: 340 Effective length of database: 366 Effective search space: 124440 Effective search space used: 124440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate CCNA_03323 CCNA_03323 (phosphoserine aminotransferase)
to HMM TIGR01365 (phosphoserine aminotransferase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01365.hmm # target sequence database: /tmp/gapView.11117.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01365 [M=374] Accession: TIGR01365 Description: serC_2: phosphoserine aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-234 763.8 1.5 1.7e-234 763.6 1.5 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_03323 CCNA_03323 phosphoserine aminotr Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_03323 CCNA_03323 phosphoserine aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 763.6 1.5 1.7e-234 1.7e-234 1 374 [] 11 389 .. 11 389 .. 1.00 Alignments for each domain: == domain 1 score: 763.6 bits; conditional E-value: 1.7e-234 TIGR01365 1 rpanpefssgpcakrpgysveelknaalgrshrsklgkeklkeaiektrevlevpadyligivaasdtgavem 73 rpa+pefssgpcakrpg+++e+l+na+lgrshrsklgk++lk+ai++trevlevpad+ligiva+sdtgavem lcl|FitnessBrowser__Caulo:CCNA_03323 11 RPARPEFSSGPCAKRPGWTPENLRNAVLGRSHRSKLGKARLKAAIDQTREVLEVPADFLIGIVAGSDTGAVEM 83 7************************************************************************ PP TIGR01365 74 alwsllgargvdllafesfgkgwvtdvtkqlklkdvrvleaeygklpdlkkvdfkkdvvftwngttsgvrvpn 146 a+ws+lgar+v+llafesfgk+wvtdvtkqlkl+dv+vl+a+yg+lpd++kvd++kd+vftwngttsgvrvpn lcl|FitnessBrowser__Caulo:CCNA_03323 84 AMWSMLGARPVQLLAFESFGKDWVTDVTKQLKLPDVEVLSAPYGQLPDTSKVDPAKDLVFTWNGTTSGVRVPN 156 ************************************************************************* PP TIGR01365 147 gdfipadreglticdatsaafaqdldyekldvvtfswqkvlggegahgvlilspravarlesytpawplpkif 219 +dfi+adreg+ticdatsaafaqdld++kldvvtfswqk+lggegahgvlilspravarlesytpawp+pk+f lcl|FitnessBrowser__Caulo:CCNA_03323 157 ADFISADREGITICDATSAAFAQDLDWTKLDVVTFSWQKALGGEGAHGVLILSPRAVARLESYTPAWPMPKLF 229 ************************************************************************* PP TIGR01365 220 rltk.....ggklskdifegetintpsmlavedaldalkwaesigglkalvaraddnlavleafvaksswvdf 287 r+tk g+k+s difeg+tintpsml+vedaldalkwa+siggl+a++arad+nl+vl+++vak++wvdf lcl|FitnessBrowser__Caulo:CCNA_03323 230 RMTKankdgGNKVSLDIFEGATINTPSMLCVEDALDALKWASSIGGLQAMQARADQNLKVLADWVAKTPWVDF 302 ********99*************************************************************** PP TIGR01365 288 laatkeirsntsvclkvvdpdvaaldedaqadfakelvsalekegvaydigsyrdapaglriwcgatveksdl 360 laat+eirsntsvclkvvdp+++al+edaqadfak+l+s+lekeg+a+dig+yrdapaglriwcgatve+sdl lcl|FitnessBrowser__Caulo:CCNA_03323 303 LAATPEIRSNTSVCLKVVDPAICALPEDAQADFAKKLASLLEKEGAALDIGGYRDAPAGLRIWCGATVEASDL 375 ************************************************************************* PP TIGR01365 361 eallewldwafalv 374 eal++wldwafa+v lcl|FitnessBrowser__Caulo:CCNA_03323 376 EALTPWLDWAFATV 389 ***********986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (374 nodes) Target sequences: 1 (396 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.89 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory