Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate CCNA_00277 CCNA_00277 succinyl-diaminopimelate desuccinylase
Query= SwissProt::Q9JYL2 (381 letters) >lcl|FitnessBrowser__Caulo:CCNA_00277 CCNA_00277 succinyl-diaminopimelate desuccinylase Length = 386 Score = 321 bits (822), Expect = 2e-92 Identities = 173/378 (45%), Positives = 231/378 (61%), Gaps = 9/378 (2%) Query: 7 LELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRRGTKAPVVCFA 66 +ELA+ LI RPSVTP D L +L +GFA + FG+ +N++ RRGT P +CFA Sbjct: 14 VELAQALIRRPSVTPADAGAMDTLQRQLEALGFACRRMKFGEIENLYARRGTARPNLCFA 73 Query: 67 GHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAKHPNHQGS 126 GHTDVVP G W + PFE ++G LYGRGA DMK++IA FV A VA P+H GS Sbjct: 74 GHTDVVPVGDDAAWTAGPFEAEIKEGVLYGRGAVDMKSAIAAFVAA----VANVPDHPGS 129 Query: 127 IALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRGSLSGN 186 I+ LIT DEEG A DGT KVV+ L A E+ID+CIVGEPT+ + LGDM+K GRRGS++ Sbjct: 130 ISFLITGDEEGVAEDGTVKVVEALAAEGEIIDHCIVGEPTSANLLGDMVKIGRRGSINAW 189 Query: 187 LTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGGTGATN 246 +TV+G+QGH+AYPH A NPV L L V D+G F P++ +I+ I+ G ATN Sbjct: 190 ITVEGRQGHVAYPHRAANPVPVLVDILSALKARVLDDGYTGFQPSNLEITTIDVGNTATN 249 Query: 247 VIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQYD----LQWSCSGQPFLTQAGKL 302 VIP + N RF+ L + K +D SG+ FLT+ G Sbjct: 250 VIPAAAKARVNIRFNPAHKGKDLAAWIEGECAKAAEGFDGAATALCKISGEAFLTEPGDF 309 Query: 303 TDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQINENVRLNDIP 362 TDV AA+ + G ELSTTGGTSD RFI+A+ ++E G +T+HQ++E V + ++ Sbjct: 310 TDVIVAAVTDATGRAPELSTTGGTSDARFIRALC-PVVEFGLVGSTMHQVDERVPVEEVR 368 Query: 363 KLSAVYEGILARLLAGNA 380 +L+ YE ++ R A A Sbjct: 369 QLAGAYEALIRRYFAAFA 386 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 386 Length adjustment: 30 Effective length of query: 351 Effective length of database: 356 Effective search space: 124956 Effective search space used: 124956 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate CCNA_00277 CCNA_00277 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.1258.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-135 436.5 0.0 4.6e-135 436.3 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_00277 CCNA_00277 succinyl-diaminopimel Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_00277 CCNA_00277 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 436.3 0.0 4.6e-135 4.6e-135 2 369 .. 14 380 .. 13 381 .. 0.97 Alignments for each domain: == domain 1 score: 436.3 bits; conditional E-value: 4.6e-135 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvvPaGelek 74 +ela+ Li+r+svtP+daga++ ++++L++lgf++++++f++++nl+a+rgt +p+l+faGhtDvvP+G++ + lcl|FitnessBrowser__Caulo:CCNA_00277 14 VELAQALIRRPSVTPADAGAMDTLQRQLEALGFACRRMKFGEIENLYARRGTARPNLCFAGHTDVVPVGDDAA 86 589********************************************************************** PP TIGR01246 75 WssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkkvvetlke 147 W++ pfe+e+++G+lygrGa+Dmk+++aafv+a+ + +dh Gs+s+lit Deeg a dGt+kvve l + lcl|FitnessBrowser__Caulo:CCNA_00277 87 WTAGPFEAEIKEGVLYGRGAVDMKSAIAAFVAAVA----NVPDHPGSISFLITGDEEGVAEDGTVKVVEALAA 155 ********************************977....89******************************** PP TIGR01246 148 rdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGn 220 e id+++vgeP+s++ lGD++kiGrrGsi++ ++++G qGhvaYPh+a nPv+ +v +l +l a+ lD+G lcl|FitnessBrowser__Caulo:CCNA_00277 156 EGEIIDHCIVGEPTSANLLGDMVKIGRRGSINAWITVEGRQGHVAYPHRAANPVPVLVDILSALKARVLDDGY 228 ************************************************************************* PP TIGR01246 221 effppsslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkh....kldYelewklsgep 289 f+ps+l+i+ i++g+ a+nviP+++k++ n+rf++ ++ ++l +e + k + + k+sge+ lcl|FitnessBrowser__Caulo:CCNA_00277 229 TGFQPSNLEITTIDVGNTATNVIPAAAKARVNIRFNPAHKGKDLAAWIEGECAKAaegfDGAATALCKISGEA 301 ********************************************9999988877644224444566899**** PP TIGR01246 290 fltkegklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsev 362 flt+ g+ ++++++a++ ++++pelst+GGtsDarfi++l + vve+Glv +t+h+v+e+v +e++++l+ lcl|FitnessBrowser__Caulo:CCNA_00277 302 FLTEPGDFTDVIVAAVTDATGRAPELSTTGGTSDARFIRAL-CPVVEFGLVGSTMHQVDERVPVEEVRQLAGA 373 *****************************************.******************************* PP TIGR01246 363 yekllee 369 ye l+++ lcl|FitnessBrowser__Caulo:CCNA_00277 374 YEALIRR 380 **99975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (386 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 12.78 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory