Align homoserine kinase (EC 2.7.1.39) (characterized)
to candidate CCNA_03475 CCNA_03475 homoserine kinase
Query= reanno::Korea:Ga0059261_3253 (319 letters) >FitnessBrowser__Caulo:CCNA_03475 Length = 317 Score = 265 bits (678), Expect = 8e-76 Identities = 142/316 (44%), Positives = 194/316 (61%), Gaps = 3/316 (0%) Query: 1 MAVYTQVSAEALAGFLARYDVGELVSAKGIAEGVENSNYLVETTRDRFILTLYEKRVEAA 60 MAVYT ++ + L FL YD+G ++ KGIAEGVENSN+L+ET + R+ILT+YE+RV+A Sbjct: 1 MAVYTDITDQELEAFLEGYDLGAPLAFKGIAEGVENSNFLLETEKGRYILTVYERRVKAE 60 Query: 61 DLPYFMGLLDHLAAKGLPVPPAIKDRGGVEIQELNGRPACLIKFLSGISLSHPTPAQARA 120 DLPYF+ +L LA +G P I R G + L G+PA +++FL G+S+ PT A R Sbjct: 61 DLPYFLNMLTWLADRGYPSARPIPTRSGATLSSLRGKPAAIVEFLPGLSVRKPTAAHCRE 120 Query: 121 AGEAMAQMHRAVADFPLDRPNSMGVDTWQPLFEKCGHSLDQIVPGLYDDLGFAIARVVPA 180 AGE +A +H A +P R N +G W PLF K + + + PGL + +A++ Sbjct: 121 AGEGLAWLHLAGEGYPGRRANDLGQAAWSPLFSKHRKAAEDLKPGLSATIDNDLAQLSLM 180 Query: 181 WTRNDFDRCAIHADLFPDNVLMRGD-QVTGLIDFYFACTDIRVYDLAVMHSAWSFDAHGR 239 W RN IHAD FPDNV + + + IDFYFAC D YD+AV +AW F+A G Sbjct: 181 WPRN-LPTGTIHADYFPDNVFFQSNGKFAAAIDFYFACDDAYAYDVAVTLNAWCFEADG- 238 Query: 240 NYDPAVGDALIAGYEASFPLTEVERAAFPTLAAGACIRFSLSRAWDWLNTPADALVMRKD 299 +++ AL+ GYE PL+ +E+ A P LA GA +RF L+R DW +TPA ALV KD Sbjct: 239 SFNITAAKALLNGYERRRPLSPIEKEALPILARGAAMRFFLTRLADWGSTPAGALVRPKD 298 Query: 300 PLAYVRRLKHYAPDLV 315 PL Y R+L + LV Sbjct: 299 PLEYERKLAVHREGLV 314 Lambda K H 0.323 0.138 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 317 Length adjustment: 27 Effective length of query: 292 Effective length of database: 290 Effective search space: 84680 Effective search space used: 84680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
Align candidate CCNA_03475 CCNA_03475 (homoserine kinase)
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00938.hmm # target sequence database: /tmp/gapView.15785.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00938 [M=307] Accession: TIGR00938 Description: thrB_alt: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-156 506.0 0.0 2.2e-156 505.8 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_03475 CCNA_03475 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_03475 CCNA_03475 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 505.8 0.0 2.2e-156 2.2e-156 1 306 [. 1 307 [. 1 308 [. 0.99 Alignments for each domain: == domain 1 score: 505.8 bits; conditional E-value: 2.2e-156 TIGR00938 1 mavytsvsdeeleafLegydlGellslkGiaeGvensnyllttdkgryvLtlyekrvkaeeLPfflellthLa 73 mavyt+++d+eleafLegydlG++l++kGiaeGvensn+ll+t+kgry+Lt+ye+rvkae+LP+fl++lt+La lcl|FitnessBrowser__Caulo:CCNA_03475 1 MAVYTDITDQELEAFLEGYDLGAPLAFKGIAEGVENSNFLLETEKGRYILTVYERRVKAEDLPYFLNMLTWLA 73 9************************************************************************ PP TIGR00938 74 erglpvakpvksrdGralseLaGkPaalvefLkGssvakPtaercrevgevlaklhlagadfkeerkndlrle 146 +rg+p+a+p+++r+G++ls+L+GkPaa+vefL+G+sv+kPta++cre+ge la+lhlag++++++r+ndl+++ lcl|FitnessBrowser__Caulo:CCNA_03475 74 DRGYPSARPIPTRSGATLSSLRGKPAAIVEFLPGLSVRKPTAAHCREAGEGLAWLHLAGEGYPGRRANDLGQA 146 ************************************************************************* PP TIGR00938 147 aWsilaakkfkvleqleeelaalldkeldalkkflprdLPrgvihadlfkdnvlldgdk.lkgvidfyfaCed 218 aWs+l++k++k++e+l+++l+a++d++l++l+ ++pr+LP+g+ihad+f+dnv++++++ ++++idfyfaC+d lcl|FitnessBrowser__Caulo:CCNA_03475 147 AWSPLFSKHRKAAEDLKPGLSATIDNDLAQLSLMWPRNLPTGTIHADYFPDNVFFQSNGkFAAAIDFYFACDD 219 *********************************************************988************* PP TIGR00938 219 allydlaiavndWcfeaddkldaaaakallkgyeavrpLseeekaafpvllrgaalrfllsrlldlvftqage 291 a++yd+a+++n+Wcfead++++++aakall+gye++rpLs++ek+a+p+l+rgaa+rf+l+rl+d+ +t+ag+ lcl|FitnessBrowser__Caulo:CCNA_03475 220 AYAYDVAVTLNAWCFEADGSFNITAAKALLNGYERRRPLSPIEKEALPILARGAAMRFFLTRLADWGSTPAGA 292 ************************************************************************* PP TIGR00938 292 lvvakdPaeferkLk 306 lv++kdP e+erkL+ lcl|FitnessBrowser__Caulo:CCNA_03475 293 LVRPKDPLEYERKLA 307 *************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (307 nodes) Target sequences: 1 (317 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.75 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory