Align cystathionine gamma-synthase (EC 2.5.1.48) (characterized)
to candidate CCNA_02321 CCNA_02321 O-succinylhomoserine sulfhydrylase
Query= BRENDA::Q1M0P5 (380 letters) >FitnessBrowser__Caulo:CCNA_02321 Length = 394 Score = 239 bits (609), Expect = 1e-67 Identities = 138/383 (36%), Positives = 224/383 (58%), Gaps = 16/383 (4%) Query: 5 TKLIHGGISEDATTGAVSVPIYQTSTYRQDAI--------GHHKGYEYSRSGNPTRFALE 56 TKLI GGI+ +Y T + D+ G G+ YSR NPT E Sbjct: 12 TKLIRGGIARSQFMETAEA-LYLTQGFTYDSAEGADRRFAGEDPGFVYSRFNNPTVKMFE 70 Query: 57 ELIADLEGGVKGFAFASGLAGIHA-VFSLLQSGDHVLLGDDVYGGTFRLFNKVLVKNGLS 115 + +A LEG A A+G+A IHA + L+++GDHV+ G ++G + ++ L + G+ Sbjct: 71 DRLALLEGAEVCRAQATGMASIHAALMGLVRAGDHVVAGRALFGSCRWIVSEWLPRFGVE 130 Query: 116 CTIIDTSDLSQIKKAIKPNTKALYLETPSNPLLKITDLAQCASVAKDHGLLTIVDNTFAT 175 T +D +D + A++PNTKA+ +ETPSNP+L+ITD+ + +A G IVDN FAT Sbjct: 131 TTFVDATDPKAWEAAMRPNTKAVLVETPSNPVLEITDIRAVSELAHAVGAKVIVDNVFAT 190 Query: 176 PYYQNPLLLGADIVVHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNAI---GGVLGP 232 P +Q PL LGAD+VV+S TK++ G V+ G + T +EA+ +E F+++++ G L P Sbjct: 191 PIFQKPLELGADVVVYSATKHIDGQGRVLGGAILT-SEAINEE--FYRDSLRHTGPSLSP 247 Query: 233 QDSWLLQRGIKTLGLRMQAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQMRG 292 ++W++ +G++TL LR++ +A +A + +H KV+ V YP P HP + +AK QM G Sbjct: 248 FNAWVMLKGLETLDLRVRRQADSAFALANTIAEHKKVQTVLYPFRPDHPGHNVAKAQMTG 307 Query: 293 FSGMLSFTLKNDSEATPFVESLKLFILGESLGGVESLVGVPAFMTHACIPKTQREAAGIR 352 +++ L + A F+ +L++ + +LG +S+ P TH +P+ +R + G+ Sbjct: 308 GGTVIALDLGSREAAFKFLNALEIVDISNNLGDAKSMATHPPTTTHRSVPEAERPSLGVT 367 Query: 353 DGLVRLSVGIEHEQDLLEDLEQA 375 +G VRLSVG+E +DL D+ +A Sbjct: 368 EGGVRLSVGLESVEDLKRDVIRA 390 Lambda K H 0.318 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 394 Length adjustment: 30 Effective length of query: 350 Effective length of database: 364 Effective search space: 127400 Effective search space used: 127400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory