Align O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (characterized)
to candidate CCNA_01491 CCNA_01491 cystathionine beta-lyase
Query= reanno::Korea:Ga0059261_3194 (402 letters) >FitnessBrowser__Caulo:CCNA_01491 Length = 386 Score = 145 bits (366), Expect = 2e-39 Identities = 106/349 (30%), Positives = 173/349 (49%), Gaps = 15/349 (4%) Query: 51 DAAARFSGDQQGMTYSRLQNPTVEMLEQRIALLEGAEACRATASGMAAMTAALLCQLSAG 110 DAA+ + DQ +TY T L+ +A LEGA SG+AA+T A+L L AG Sbjct: 35 DAASLYDDDQ--LTYGITGLSTPVALQNALAELEGATNVTLYPSGLAAITGAMLAVLKAG 92 Query: 111 DHLIGGRAAFGSCRWLTDTQLPKFGIETTVVDAR-DPQQFIDAIRPNTKVFFFETPANPT 169 D ++ +A+ R D L +FG+ T D + P+ + + +T++ E P + T Sbjct: 93 DEVLVVDSAYKPTRRFCDRVLGRFGVTTRYYDPKLSPEALMGLVTSSTRLIVLEAPGSLT 152 Query: 170 MDVVDLKAVCAIARERGIVTVVDNAFATPALQRPMDFGADVVAYSATKMMDGQGRVLAGA 229 ++ D+ A+ A A RG++T++DN +A L +P+ G + + TK + G G+ Sbjct: 153 FEMQDIPAIAAAANARGVLTLIDNTWAAGLLFKPLAHGVTMSVQALTKYVGGHSDCFMGS 212 Query: 230 VCGTEEFINNTLLPFHRNTGPTLSPFNAWVVLKGLETLDLRIQRQSENALKVARFLEGR- 288 V ++ + L + G ++S +A+ +L+GL TL R+ R +EN L +AR+L+ R Sbjct: 213 VATCDDAVAKLLGDAMWDIGWSVSSDDAYTMLRGLRTLATRLPRHAENGLAIARWLQERP 272 Query: 289 -VPRVNFPGLPSHPQHNLAMSQMAAAGPIFSIELDGGRTQA-HGLLDALGLIDISNNIG- 345 V RV P LP H + A +F + L +A H LD+L L + + G Sbjct: 273 EVARVLHPALPGDAGHAIWKRDFTGACGLFGVVLKPCSQKAVHAFLDSLKLFGLGFSWGG 332 Query: 346 -DSRSLMTHPASTTHSGVAEDQRLLMGVGEGMLRLNVGLEDPEDLIADL 393 +S +L P S + + + +LR ++GLE EDL ADL Sbjct: 333 YESLALNCDPQLGARS-------IPVDLEGPLLRFHIGLEGIEDLKADL 374 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 386 Length adjustment: 31 Effective length of query: 371 Effective length of database: 355 Effective search space: 131705 Effective search space used: 131705 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory