Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate CCNA_03271 CCNA_03271 methionine gamma-lyase
Query= SwissProt::P55218 (403 letters) >FitnessBrowser__Caulo:CCNA_03271 Length = 401 Score = 319 bits (817), Expect = 1e-91 Identities = 171/390 (43%), Positives = 238/390 (61%), Gaps = 7/390 (1%) Query: 19 FDTLAVRAGQRRTPEGEHGEA---LFTTSSYVFRTAADAAARFAGEVPGNVYSRYTNPTV 75 F T A+ AG P EHG L TS++ F +A FAG G+ YSR +NPT Sbjct: 8 FSTRAIHAGY--DPADEHGALTPPLHLTSTFAFESAEAGGEMFAGTREGHFYSRISNPTT 65 Query: 76 RTFEERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFKR 135 E R+A+LEGAE AVATASGM AI A + S +GD V+ ++++G T + R Sbjct: 66 DLLERRLASLEGAEAAVATASGMGAITATLWSFLRAGDEVITDQTLYGCTFAFLRDGLTR 125 Query: 136 FGIQVDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHAKGALLAVDN 195 FG+ V ++ AA T++ + E+P+NP LVDIAA+ IAHA GA + VDN Sbjct: 126 FGVTVKQVDMTRPETLAAAISDQTRIVYFETPANPNMRLVDIAAITRIAHAAGAKVVVDN 185 Query: 196 CFCTPALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMKEV--VGFLRTAGPTL 253 + TP L +PL LGAD+V+HSATKY+ G G +GG+ AG E M V G G + Sbjct: 186 TYATPCLTRPLALGADIVVHSATKYLGGHGDLVGGIAAGGIEDMARVRLCGVKDMTGAVM 245 Query: 254 SPFNAWLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQHELARRQQ 313 SPF A+L L+GL+TL +RM HS SA A+A WLE P +E+V+Y GL S PQ +LA RQ Sbjct: 246 SPFTAFLVLRGLKTLSLRMARHSQSAQAVARWLEDHPAVEQVFYPGLQSFPQRDLAARQM 305 Query: 314 SGFGAVVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRARA 373 + G +++F++KGG A ++ ++ +LGD +T I HPA+ +H +PE+RA A Sbjct: 306 AAGGGMMAFELKGGHAAGVAMMNRLALIRRAVSLGDAETLIQHPASMTHSPYTPEERAAA 365 Query: 374 GIGDSLIRVAVGLEDLDDLKADMARGLAAL 403 GIG+ ++R++VGLED+ D+ AD+A L L Sbjct: 366 GIGEGMVRLSVGLEDVADILADLAMALEPL 395 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 401 Length adjustment: 31 Effective length of query: 372 Effective length of database: 370 Effective search space: 137640 Effective search space used: 137640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory