Align prephenate dehydratase (EC 4.2.1.51) (characterized)
to candidate CCNA_03028 CCNA_03028 prephenate dehydratase
Query= BRENDA::Q5NLV8 (337 letters) >FitnessBrowser__Caulo:CCNA_03028 Length = 283 Score = 221 bits (562), Expect = 2e-62 Identities = 131/279 (46%), Positives = 171/279 (61%), Gaps = 8/279 (2%) Query: 54 LSPTKAVAFQGAPGCNSNIAIQDLFPDSLPLPCFSFADALTAVKEGRAGRAMIPIENSLN 113 +S K +AFQG PG NS+ A + FPD PC +F +A A+K G A MIPIENS+ Sbjct: 1 MSLLKKIAFQGEPGANSHEACRTYFPDYEAYPCKTFEEAFEAIKSGVAQLGMIPIENSIA 60 Query: 114 GRVADMHFLLPESGLTIQAEYFLPINHCLVAPKGA--GEITHVLSHPQALGQCRHWLQAH 171 GRVAD+H LLP SGL I E F PI L+A KG +I V S P AL QCR+ L+ Sbjct: 61 GRVADVHHLLPASGLKIIGERFKPIRFQLMANKGVKLEDIKVVSSMPIALSQCRNSLKRL 120 Query: 172 NLRALAHADTAGAAAEVADRKQAGLAALSPALAAKLYGLEILEKGIADGDTNITRFVVLA 231 + A DTAGAA +A + AA++PALAA++YGL+IL + I D N TRF+V+ Sbjct: 121 GVETEAAGDTAGAAKALALKPNPTHAAVAPALAAEIYGLDILARDIEDERHNTTRFLVMT 180 Query: 232 EADTALQDLPPIRQNLSGKMMTSLLFTVKNTPSALLNAIKGFGDNQVNMTKLESYQHGAS 291 D P + + + +TS +F V+N P+AL A+ GF N VNMTKLESY G + Sbjct: 181 ------ADKAPAAPDFTHRCVTSFVFRVRNLPAALYKALGGFATNGVNMTKLESYMEGGN 234 Query: 292 FSATQFYADVEGEPSEDNVARALDILQENACDLRILGVY 330 F+AT FYA+V+G P + N+A ALD L+ + ILGVY Sbjct: 235 FTATFFYAEVDGRPEDRNLALALDELKFFSERFEILGVY 273 Lambda K H 0.318 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 283 Length adjustment: 27 Effective length of query: 310 Effective length of database: 256 Effective search space: 79360 Effective search space used: 79360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory