Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate CCNA_00727 CCNA_00727 ribosomal-protein-alanine acetyltransferase
Query= BRENDA::Q8P8J7 (203 letters) >FitnessBrowser__Caulo:CCNA_00727 Length = 198 Score = 106 bits (265), Expect = 2e-28 Identities = 69/187 (36%), Positives = 101/187 (54%), Gaps = 5/187 (2%) Query: 16 LRGQHVTLEPLRAAHADGLRAAVADGALSRLW-YTSVPSAAQVDDYIAAALAAQAD-GTA 73 L+G++V LEP+ H D L+AA+ S W SV + + AL + D G Sbjct: 9 LQGRYVRLEPVTVDHHDELKAAIDCDPAS--WEIMSVNGCGEGFEDFWGALQGETDRGER 66 Query: 74 LPFVVRDAA-GEIAGSTRYYALDASVPKLSIGYTWYAPRVQRTGLNTEAKRLLLGHAFET 132 + F +R G++ G++ Y + L IG T+ P + +N E+KRL+LGHAF+ Sbjct: 67 IGFAIRRLVDGKVVGTSSYLNIRRLHGGLEIGATFLNPEARSGPVNPESKRLMLGHAFDK 126 Query: 133 LGCLSVVFETSWFNHTSRAAIARLGAKQDGVLRNHTRHADGTPRDTVVFSIINAEWAGVK 192 G + V T N S+AAI +LGA ++GVLRNH G RDT VFSI + +W ++ Sbjct: 127 AGAIRVELVTDVRNARSQAAIQKLGATKEGVLRNHKVTWTGHVRDTAVFSITDYDWPAIR 186 Query: 193 RHLQFRL 199 L+FRL Sbjct: 187 ERLEFRL 193 Lambda K H 0.321 0.131 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 92 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 203 Length of database: 198 Length adjustment: 21 Effective length of query: 182 Effective length of database: 177 Effective search space: 32214 Effective search space used: 32214 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory