Align Cyclohexadienyl dehydrogenase and ADH prephenate dehydrogenase (characterized, see rationale)
to candidate CCNA_02307 CCNA_02307 cyclohexadienyl dehydrogenase
Query= uniprot:Q92MG1 (307 letters) >FitnessBrowser__Caulo:CCNA_02307 Length = 312 Score = 334 bits (857), Expect = 1e-96 Identities = 173/300 (57%), Positives = 210/300 (70%), Gaps = 3/300 (1%) Query: 5 FQTIALIGIGLIGSSIARDIREKQLAGTIVVTTRSEATLKRAGELGLGDRYTLSAAEAVE 64 + + +IG GLIG S+ R R+ + G I V SEA R ELG+ + T AEAV+ Sbjct: 8 YPKLTVIGCGLIGGSVIRAARQHGVVGEITVADASEAHRARVTELGIAEHVTGDIAEAVK 67 Query: 65 GADLVVVSVPVGASGAVAAEIAAHLKPGAIVTDVGSTKGSVIAQMAPHLPKDVHFVPGHP 124 ADLVV++ PV + +A + +KPGA +TDVGSTKG+V + +PGHP Sbjct: 68 DADLVVIATPVLSVPELARVVIPAMKPGATLTDVGSTKGNVAEAFRAQDLSKIFAIPGHP 127 Query: 125 IAGTEHSGPDAGFAGLFRGRWCILTPPAGTDEE---AVARLRLFWETLGSMVDEMDPKHH 181 IAGTE SGPDAGFA LF RW ILTP D+ AVA+L FW G+ V+ MD KHH Sbjct: 128 IAGTEQSGPDAGFAELFENRWTILTPFESEDDHYAAAVAKLSAFWRAFGAQVELMDDKHH 187 Query: 182 DKVLAIVSHLPHIIAYNIVGTADDLETVTESEVIKYSASGFRDFTRLAASDPTMWRDVCL 241 D VLA+VSHLPH+IAY IVG+A DLE VTE+EVIKYSASGFRDFTR+AASDPTMWRD+ + Sbjct: 188 DLVLAVVSHLPHLIAYTIVGSAADLENVTENEVIKYSASGFRDFTRIAASDPTMWRDIFV 247 Query: 242 HNKDAILEMLARFSEDLASLQRAIRWGDGDKLFDLFTRTRAIRRSIVQAGQDTAMPDFGR 301 NKDA+LEML RF+EDL ++ RAIRWGD D L FTRTRAIRR IV AGQ++A P+FGR Sbjct: 248 ANKDAVLEMLGRFTEDLQAMSRAIRWGDADTLHAHFTRTRAIRRGIVAAGQESAEPNFGR 307 Lambda K H 0.320 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 312 Length adjustment: 27 Effective length of query: 280 Effective length of database: 285 Effective search space: 79800 Effective search space used: 79800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory