Align Aromatic-amino-acid aminotransferase (EC 2.6.1.57) (characterized)
to candidate CCNA_03215 CCNA_03215 ARO8 family aminotransferase/HTH DNA-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_1015 (396 letters) >FitnessBrowser__Caulo:CCNA_03215 Length = 471 Score = 120 bits (300), Expect = 1e-31 Identities = 114/389 (29%), Positives = 164/389 (42%), Gaps = 39/389 (10%) Query: 6 RLNNVETSAIRELFKLLGKPGIISFAGGFPDSAMFDVEGIRAASNAALAE-EPGAALQYG 64 R+N E I L P ++ AG D A+ A LA EP + Y Sbjct: 114 RINEDEAGLIDLSMNLPPPPQGLNLAGLLQD-----------ATRAILARTEPATLMAYH 162 Query: 65 ATEGYNPLREQLAAFMTSKGAKDVAADNLIVTTGSQQALDLLGKTLISPGDKVIVEGPTF 124 G R AA++ V ++VT G+Q AL L L +PGD +IVE T+ Sbjct: 163 PGAGSLAQRSAGAAWLAPT-LGPVDPGRVVVTGGAQTALSALLDYLAAPGDTIIVEAFTY 221 Query: 125 LATIQCFRLYGAELISAPIDGNGVKTDELEKLIAEHKPKFVYLIPTFGNPSGAMLSLERR 184 + R G L++ P+D G++ + L +L+A+H P+ + PTF NP+ A +S RR Sbjct: 222 PGLLATARRRGLTLVACPLDDEGLQPEALAQLVAQHGPRLICCTPTFQNPTAATMSPARR 281 Query: 185 KAVLEMAVKHNTLIVEDDPYGDLYFGDAPPPSLLNLSATVPGSRELLVHCGSLSKVLSPG 244 AV+E+A I+EDD YG L AP L+A P E + H + +K LSPG Sbjct: 282 AAVIEIARAAGVTILEDDAYGLLPASPAPA-----LAALWP---EGVYHVATTAKALSPG 333 Query: 245 LRVGWMIAPAELLGKATMCKQFSDAHTSTFAQATAAQYLKAGRMPGTLANVRKVYAERAQ 304 LR+ +++AP + Q+++ G LA VR R Sbjct: 334 LRLAYVVAPPGCAEGFAQALHAIAQMPAPLMAGIVTQWIRDGVAAKVLAGVRSEAVARRA 393 Query: 305 AMGDALRKELGDAIEFVQPQGGLFVWARLTGAGGKVADGNVLAKRAIEKGVAFVPGTPFF 364 L + +GDA L VW L GA A A E+G+A V F Sbjct: 394 LAATLLPRAVGDA-------ESLHVW--LAGAEAPPA--------ARERGLALVGANAFR 436 Query: 365 CANPDHATFRLSF-ATADVDKIREGVARL 392 R+S ATA + +G+ L Sbjct: 437 APGVTGEGLRISLGATAKRAALTQGLKAL 465 Lambda K H 0.319 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 518 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 471 Length adjustment: 32 Effective length of query: 364 Effective length of database: 439 Effective search space: 159796 Effective search space used: 159796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory