GapMind for Amino acid biosynthesis

 

Aligments for a candidate for CGL in Echinicola vietnamensis KMM 6221, DSM 17526

Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate Echvi_1734 Echvi_1734 Cystathionine beta-lyases/cystathionine gamma-synthases

Query= BRENDA::Q5H4T8
         (397 letters)



>lcl|FitnessBrowser__Cola:Echvi_1734 Echvi_1734 Cystathionine
           beta-lyases/cystathionine gamma-synthases
          Length = 369

 Score =  298 bits (764), Expect = 1e-85
 Identities = 162/378 (42%), Positives = 230/378 (60%), Gaps = 14/378 (3%)

Query: 15  LSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPGEHQGFEYSRTHNPTRFAYERCVA 74
           +   TLAIHGG+       AV+ PI  ++T+        +   YSR+ NP R A E  +A
Sbjct: 1   MKFETLAIHGGEKKSAPHRAVVQPITLSTTFEH----HEESLIYSRSQNPNRMALEELLA 56

Query: 75  ALEGGTRAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAGLDFSFV 134
            LE G+ A AF+SG AA   V + L  GSH+VA  D+Y G  +  + V      L+ +F 
Sbjct: 57  QLEKGSAAAAFSSGNAAGMAVFQALPLGSHIVAPSDMYHGLKK--QLVELFKDKLEVTFT 114

Query: 135 DLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQ 194
           DL+DP   + AI+ +TK++WIETP+NPMLK+ DI  +  +A++  +  V DNTFA+P+ Q
Sbjct: 115 DLSDPENLEKAIQPNTKLLWIETPSNPMLKISDIRRLTKMAKEDDIRVVCDNTFATPVFQ 174

Query: 195 RPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQGPFDSFLA 254
            PL LGADLV+HSATKY  GHSD++GG  +   + E  +Q+  +Q + G V  PFD +L 
Sbjct: 175 NPLELGADLVMHSATKYFGGHSDILGGALITKKSDEFWKQIVNVQQTGGAVLSPFDCYLL 234

Query: 255 LRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQMSGFGGIVS 314
           +R +KTL  RMR H E+A  +A +L+ HP +E+V YPGL +HP H +AK QM+GFGGI+S
Sbjct: 235 VRSIKTLAYRMRGHAEHAGMIATFLDQHPKVERVFYPGLTAHPGHDVAKSQMTGFGGILS 294

Query: 315 IVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGISDALVR 374
            ++KG  + A +     + +T A SLGGVESL+   A +        +         L+R
Sbjct: 295 FLVKGKPEDADKLISSLKYYTNATSLGGVESLIERRAAVEGPDTKTPQN--------LIR 346

Query: 375 LSVGIEDLGDLRGDLERA 392
           LSVG+E L DL  D+E+A
Sbjct: 347 LSVGLEHLDDLLEDMEKA 364


Lambda     K      H
   0.320    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 428
Number of extensions: 14
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 397
Length of database: 369
Length adjustment: 30
Effective length of query: 367
Effective length of database: 339
Effective search space:   124413
Effective search space used:   124413
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory