Align Serine acetyltransferase, plasmid; SAT; EC 2.3.1.30 (characterized)
to candidate Echvi_0221 Echvi_0221 Serine acetyltransferase
Query= SwissProt::Q59967 (319 letters) >FitnessBrowser__Cola:Echvi_0221 Length = 280 Score = 181 bits (458), Expect = 2e-50 Identities = 95/198 (47%), Positives = 128/198 (64%), Gaps = 6/198 (3%) Query: 107 QGTPEATPAVLSQHASELTQAFAQALPEIKRLLDSDVNAAYLGDPAAQSISEILFCYPGI 166 QG ++ + + + AF L ++ + D+ A + GDPAA+S +E++ YPG Sbjct: 65 QGILGKNKRLIDEESEAVAAAFFDRLSDVYDAIHEDIQAMFEGDPAAKSTTEVIRSYPGF 124 Query: 167 TAITFHRLAHRLYQLGLPLLARITAEVSHSETGIDIHPGAAIGGSFFIDHGTGVVIGETC 226 AI +R+AH L + G+ L+ R+ E +HS+TGIDIHPGA+IG F IDHGTGVVIGET Sbjct: 125 YAIAAYRIAHLLQEQGVSLIPRMITEFAHSKTGIDIHPGASIGRFFCIDHGTGVVIGETT 184 Query: 227 VIGDRVRIYQAVTLGAKSFPRDETGALIKGQARHPVIEDDVVIYAGATLL-GRITVGRGS 285 IGD V++YQ VTLGA S +++ RHP I D VVIYAGAT+L G+ +G S Sbjct: 185 KIGDHVKLYQGVTLGALSVNKEDADI-----QRHPTIGDHVVIYAGATILGGKTVIGPES 239 Query: 286 TIGGNVWLTRSVPAGSFI 303 IGGNVWLT+S+PA S I Sbjct: 240 VIGGNVWLTKSIPAKSKI 257 Lambda K H 0.320 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 280 Length adjustment: 27 Effective length of query: 292 Effective length of database: 253 Effective search space: 73876 Effective search space used: 73876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory