Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate Echvi_3161 Echvi_3161 Lactate dehydrogenase and related dehydrogenases
Query= BRENDA::P0A9T0 (410 letters) >FitnessBrowser__Cola:Echvi_3161 Length = 331 Score = 105 bits (263), Expect = 1e-27 Identities = 79/261 (30%), Positives = 126/261 (48%), Gaps = 13/261 (4%) Query: 57 IGLRSRTHLTEDVINAAEKLVA--IGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAE 114 I L S + +V++ KL I G N VDL+ AA+ I V P + ++AE Sbjct: 47 IALFSNDDASSEVLDILHKLGIKFIALRSAGFNHVDLEKAAELNIKVARVPAYSPYAIAE 106 Query: 115 LVIGELLLLLRGVPEANAKAHRGVWNKLAAGSFEARGKKLGIIGYGHIGTQLGILAESLG 174 + +L L R + +A+ + ++ F+ GK +G+IG G IG+ L + G Sbjct: 107 HTMALILALNRRLIKAHNRVREQNFSLNGLTGFDLNGKTVGVIGTGKIGSVLVKILHGFG 166 Query: 175 MYVYFYDIENKLPLGNATQVQH--LSDLLNMSDVVSLHVPENPSTKNMMGAKEISLMKPG 232 + DIE L + + + + L +D++SLHVP STK+++ + I+LMK G Sbjct: 167 CNILAQDIEESKDLIDKYGLIYSDCATLCKHADIISLHVPLKASTKHLINKEHIALMKSG 226 Query: 233 SLLINASRGTVVDIPALCDALASKHLAGAAIDVFPTEPA---------TNSDPFTSPLCE 283 +LIN SRG +VD A+ + L +K + +DV+ E D + L Sbjct: 227 VMLINTSRGGLVDTKAVIEGLKTKKIGYLGLDVYEEEEGLFFEDHSDDILQDDVIARLMT 286 Query: 284 FDNVLLTPHIGGSTQEAQENI 304 F+NVL+T H T+ A NI Sbjct: 287 FNNVLITSHQAFLTKTALTNI 307 Lambda K H 0.318 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 331 Length adjustment: 30 Effective length of query: 380 Effective length of database: 301 Effective search space: 114380 Effective search space used: 114380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory