Align 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate Echvi_2516 Echvi_2516 imidazoleglycerol phosphate synthase, cyclase subunit
Query= curated2:A0B7W4 (242 letters) >FitnessBrowser__Cola:Echvi_2516 Length = 251 Score = 113 bits (283), Expect = 3e-30 Identities = 71/230 (30%), Positives = 122/230 (53%), Gaps = 7/230 (3%) Query: 1 MTFDIFPAVDLRGGRCVQLVQGVPGSEVVSLDDPLVQAVRWADMGADHLHIIDLDGAIEG 60 +T I P +D++ GR V+ GV ++ DP+ A ++D GAD L +D+ ++ Sbjct: 2 LTKRIIPCLDIKEGRTVK---GVNFVDLRDAGDPVELAKVYSDEGADELVFLDITATVDK 58 Query: 61 TRLNAPILRRIVGELEVFVQVGGGIRSRSDVAEVLDTGVDRVILGTMALRDPPVVKELAE 120 + A ++ R+ + + VGGGI + DV +L+ G D++ + + A++ P V+ E+A Sbjct: 59 RKTLAELVTRVAKAINIPFTVGGGISTVEDVKVLLNAGADKISINSAAVKRPEVIDEMAA 118 Query: 121 EYGPDRIMVALDVR--DG--RVTSEGWQRTLEFDAIELGIVFESFGAGSILFTNIDTEGQ 176 E+G I+VA+D R DG V + G ++ GAG IL T++D +G Sbjct: 119 EFGSQCIVVAIDTRNVDGVDLVHTHGGRKPTTLQTQAWAKEVADRGAGEILLTSMDHDGT 178 Query: 177 QRGVDPEPTRELVEAVSIPVIAAGGVSSLDDIKLLSDAGAAGAVIGTAIY 226 + G T E+ A++IPVIA+GG ++ K + AG A A + +I+ Sbjct: 179 KAGFADGLTSEISAALTIPVIASGGAGTMPHFKSVFTAGKADAALAASIF 228 Lambda K H 0.319 0.140 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 251 Length adjustment: 24 Effective length of query: 218 Effective length of database: 227 Effective search space: 49486 Effective search space used: 49486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory