Align 3-isopropylmalate dehydratase small subunit 1; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1; EC 4.2.1.33 (characterized)
to candidate Echvi_2060 Echvi_2060 3-isopropylmalate dehydratase, small subunit
Query= SwissProt::P04787 (201 letters) >FitnessBrowser__Cola:Echvi_2060 Length = 197 Score = 158 bits (400), Expect = 5e-44 Identities = 86/193 (44%), Positives = 120/193 (62%), Gaps = 5/193 (2%) Query: 3 EKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDEKGQQPNPEFV 62 +KF VVPL NVDTD IIP +FL+ R GFG +LF DWR+ D +G P +FV Sbjct: 4 DKFNILKSTVVPLPTENVDTDQIIPARFLKATERKGFGDNLFRDWRY-DSEGN-PKADFV 61 Query: 63 LNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLLPV 122 LN Y G +L+A +NFG GSSREHA WA+ DYGF+ V++ FADIF N+ N +LPV Sbjct: 62 LNDATYSG-KVLVAGKNFGSGSSREHAAWAIYDYGFRCVVSSFFADIFKNNALNIGILPV 120 Query: 123 TLSDAQVDELFALVKANPGIKFEVDLEAQVVK--AGDKTYSFKIDDFRRHCMLNGLDSIG 180 T++ ++E+FA V+ +P + EVD+E Q + + + SF I+ +++ M NG D I Sbjct: 121 TVTPEFLEEIFAEVEKDPATEVEVDIEKQTITLLSTGNSESFDINSYKKQNMQNGFDDID 180 Query: 181 LTLQHEDAIAAYE 193 L +D I +E Sbjct: 181 YLLNMKDQIVEFE 193 Lambda K H 0.321 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 197 Length adjustment: 21 Effective length of query: 180 Effective length of database: 176 Effective search space: 31680 Effective search space used: 31680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate Echvi_2060 Echvi_2060 (3-isopropylmalate dehydratase, small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.5999.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.5999.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.