GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvD in Echinicola vietnamensis KMM 6221, DSM 17526

Align Dihydroxy-acid dehydratase, mitochondrial; DAD; 2,3-dihydroxy acid hydrolyase; EC 4.2.1.9 (characterized)
to candidate Echvi_2055 Echvi_2055 dihydroxy-acid dehydratase

Query= SwissProt::P39522
         (585 letters)



>lcl|FitnessBrowser__Cola:Echvi_2055 Echvi_2055 dihydroxy-acid
           dehydratase
          Length = 561

 Score =  602 bits (1552), Expect = e-176
 Identities = 299/563 (53%), Positives = 404/563 (71%), Gaps = 9/563 (1%)

Query: 23  LNKYSYIITEPKGQGASQAMLYATGFKKEDFKKPQVGVGSCWWSGNPCNMHLLDLNNRCS 82
           L KYS+ I++ +   A+ AMLYATG   +  K+P VGV SC +  NPCNMHL        
Sbjct: 5   LKKYSWEISDNEENPAAMAMLYATGITDKKMKQPFVGVASCGYESNPCNMHLNSFAEDIK 64

Query: 83  QSIEKAGLKAMQFNTIGVSDGISMGTKGMRYSLQSREIIADSFETIMMAQHYDANIAIPS 142
            S  +A L    FNTIG+SDG SMGT GMRYSL SRE+IADS E+ ++   +D  + IP 
Sbjct: 65  ASTNQADLSGFIFNTIGISDGQSMGTSGMRYSLPSREVIADSIESFILGHSFDGVVTIPG 124

Query: 143 CDKNMPGVMMAMGRHNRPSIMVYGGTILPGHPTCGSSKISKNIDIVSAFQSYGEYISKQF 202
           CDKNMPGV+M M R NRP IMV+GGTI  G+         + ++IVSAF++YG+ I+ Q 
Sbjct: 125 CDKNMPGVVMGMLRVNRPGIMVFGGTIRSGNYK------GEKLNIVSAFEAYGKKINGQI 178

Query: 203 TEEEREDVVEHACPGPGSCGGMYTANTMASAAEVLGLTIPNSSSFPAVSKEKLAECDNIG 262
           ++E+   V+++ACPG G+CGGMYTANTM+SA E +GL++P SSS+PA SKEK  EC NIG
Sbjct: 179 SDEDYMGVIKNACPGAGACGGMYTANTMSSAIEAMGLSLPFSSSYPATSKEKREECKNIG 238

Query: 263 EYIKKTMELGILPRDILTKEAFENAITYVVATGGSTNAVLHLVAVAHSAGVKLSPDDFQR 322
           +YIK+ + L I P+DI+TK++ ENA+   VA GGSTNA LH++A+A +AG+  + +DF+R
Sbjct: 239 KYIKQLLALDIKPKDIITKKSLENAVRVTVALGGSTNAALHILAIARTAGIDFTLEDFKR 298

Query: 323 ISDTTPLIGDFKPSGKYVMADLINVGGTQSVIKYLYENNMLHGNTMTVTGDTLAERAKKA 382
           I+  TP++GDFKPSGK++M DL  +GG  + +KY     +LHG+ +TVTG T+AE  +  
Sbjct: 299 INAETPVLGDFKPSGKFMMEDLYEMGGLPAFLKYFLNEGLLHGDCLTVTGKTMAENLEDI 358

Query: 383 -PSLPEGQEIIKPLSHPIKANGHLQILYGSLAPGGAVGKITGKEGTYFKGRARVFEEEGA 441
            P  P  + +I PL +PIK +GHL +L+G+LAP GAV KI+GKEG  F G A+VF++E +
Sbjct: 359 DPVKPSKESVIHPLDNPIKPSGHLCVLHGNLAPEGAVAKISGKEGKSFTGTAKVFDDEPS 418

Query: 442 FIEALERGEIKKGEKTVVVIRYEGPRGAPGMPEMLKPSSALMGYGLGKDVALLTDGRFSG 501
              A++  EI+KG+  VVVIRY GP+G PGMPEMLKP+S ++G GLG DVAL+TDGRFSG
Sbjct: 419 ANAAMKNKEIQKGD--VVVIRYVGPKGGPGMPEMLKPTSIIIGAGLGSDVALITDGRFSG 476

Query: 502 GSHGFLIGHIVPEAAEGGPIGLVRDGDEIIIDADNNKIDLLVSDKEMAQRKQSWVAPPPR 561
           G+HGF++GH+ PEA  GGPIGL++DGD I IDA++ +I + VS+ E A+RK++W      
Sbjct: 477 GTHGFVVGHVTPEAYLGGPIGLLKDGDVITIDAESLEIRVDVSEAEFAERKKNWKNKDLS 536

Query: 562 YTRGTLSKYAKLVSNASNGCVLD 584
           + +GTL KY +LVS AS GCV D
Sbjct: 537 HLQGTLKKYVQLVSTASEGCVTD 559


Lambda     K      H
   0.315    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1044
Number of extensions: 50
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 585
Length of database: 561
Length adjustment: 36
Effective length of query: 549
Effective length of database: 525
Effective search space:   288225
Effective search space used:   288225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)

Align candidate Echvi_2055 Echvi_2055 (dihydroxy-acid dehydratase)
to HMM TIGR00110 (ilvD: dihydroxy-acid dehydratase (EC 4.2.1.9))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00110.hmm
# target sequence database:        /tmp/gapView.4309.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00110  [M=543]
Accession:   TIGR00110
Description: ilvD: dihydroxy-acid dehydratase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                            -----------
     9e-224  729.9   3.6     1e-223  729.7   3.6    1.0  1  lcl|FitnessBrowser__Cola:Echvi_2055  Echvi_2055 dihydroxy-acid dehydr


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Cola:Echvi_2055  Echvi_2055 dihydroxy-acid dehydratase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  729.7   3.6    1e-223    1e-223       2     542 ..      21     559 ..      20     560 .. 0.99

  Alignments for each domain:
  == domain 1  score: 729.7 bits;  conditional E-value: 1e-223
                            TIGR00110   2 arallkatGlkdedlekPiiavvnsyteivPghvhlkdlaklvkeeieaaGgvakefntiavsDGiamgheGmk 75 
                                          a a+l+atG++d+ +++P+++v+++  e +P+++hl+ +a+ +k++ ++a    + fnti++sDG +mg++Gm+
  lcl|FitnessBrowser__Cola:Echvi_2055  21 AMAMLYATGITDKKMKQPFVGVASCGYESNPCNMHLNSFAEDIKASTNQADLSGFIFNTIGISDGQSMGTSGMR 94 
                                          579*********************************************************************** PP

                            TIGR00110  76 ysLpsreiiaDsvetvvkahalDalvvissCDkivPGmlmaalrlniPaivvsGGpmeagktklsekidlvdvf 149
                                          ysLpsre+iaDs+e+ + +h +D++v+i+ CDk++PG++m++lr+n+P i+v GG++ +g++k +ek+++v++f
  lcl|FitnessBrowser__Cola:Echvi_2055  95 YSLPSREVIADSIESFILGHSFDGVVTIPGCDKNMPGVVMGMLRVNRPGIMVFGGTIRSGNYK-GEKLNIVSAF 167
                                          ***************************************************************.9********* PP

                            TIGR00110 150 eavgeyaagklseeeleeiersacPtagsCsGlftansmacltealGlslPgsstllatsaekkelakksgkri 223
                                          ea+g+  +g++s+e+   + ++acP+ag+C+G++tan+m+++ ea+GlslP ss+ +ats+ek+e +k++gk+i
  lcl|FitnessBrowser__Cola:Echvi_2055 168 EAYGKKINGQISDEDYMGVIKNACPGAGACGGMYTANTMSSAIEAMGLSLPFSSSYPATSKEKREECKNIGKYI 241
                                          ************************************************************************** PP

                            TIGR00110 224 velvkknikPrdiltkeafenaitldlalGGstntvLhllaiakeagvklslddfdrlsrkvPllaklkPsgkk 297
                                          ++l+  +ikP+di+tk+++ena+ + +alGGstn+ Lh+laia++ag++++l+df+r++ ++P+l+++kPsgk 
  lcl|FitnessBrowser__Cola:Echvi_2055 242 KQLLALDIKPKDIITKKSLENAVRVTVALGGSTNAALHILAIARTAGIDFTLEDFKRINAETPVLGDFKPSGKF 315
                                          ************************************************************************** PP

                            TIGR00110 298 viedlhraGGvsavlkeldkegllhkdaltvtGktlaetlekvk.vlrvdqdvirsldnpvkkegglavLkGnl 370
                                          ++edl + GG++a lk+  +egllh d+ltvtGkt+ae+le+++ v++ +++vi++ldnp+k  g+l vL+Gnl
  lcl|FitnessBrowser__Cola:Echvi_2055 316 MMEDLYEMGGLPAFLKYFLNEGLLHGDCLTVTGKTMAENLEDIDpVKPSKESVIHPLDNPIKPSGHLCVLHGNL 389
                                          ******************************************9735667888********************** PP

                            TIGR00110 371 aeeGavvkiagveedilkfeGpakvfeseeealeailggkvkeGdvvviryeGPkGgPGmremLaPtsalvglG 444
                                          a+eGav+ki+g+e     f+G+akvf++e  a +a+ ++++++Gdvvviry GPkGgPGm+emL+Pts ++g+G
  lcl|FitnessBrowser__Cola:Echvi_2055 390 APEGAVAKISGKEG--KSFTGTAKVFDDEPSANAAMKNKEIQKGDVVVIRYVGPKGGPGMPEMLKPTSIIIGAG 461
                                          **************..99******************************************************** PP

                            TIGR00110 445 LgkkvaLitDGrfsGgtrGlsiGhvsPeaaegGaialvedGDkikiDienrkldlevseeelaerrakakkkea 518
                                          Lg++vaLitDGrfsGgt+G+++Ghv+Pea+ gG+i+l++dGD i+iD+e+ ++ ++vse+e+aer++++k+k+ 
  lcl|FitnessBrowser__Cola:Echvi_2055 462 LGSDVALITDGRFSGGTHGFVVGHVTPEAYLGGPIGLLKDGDVITIDAESLEIRVDVSEAEFAERKKNWKNKDL 535
                                          ************************************************************************** PP

                            TIGR00110 519 revkgaLakyaklvssadkGavld 542
                                           + +g+L+ky +lvs+a++G+v+d
  lcl|FitnessBrowser__Cola:Echvi_2055 536 SHLQGTLKKYVQLVSTASEGCVTD 559
                                          **********************98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (543 nodes)
Target sequences:                          1  (561 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.01s 00:00:00.04 Elapsed: 00:00:00.04
# Mc/sec: 7.41
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory