Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate Echvi_4516 Echvi_4516 Dihydrodipicolinate synthase/N-acetylneuraminate lyase
Query= BRENDA::P0A6L2 (292 letters) >FitnessBrowser__Cola:Echvi_4516 Length = 309 Score = 117 bits (293), Expect = 3e-31 Identities = 70/243 (28%), Positives = 125/243 (51%), Gaps = 2/243 (0%) Query: 4 GSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMT 63 G I +VTPMD G V ++KL+++ ++ G + +GTTGE ++L+ + +++ T Sbjct: 12 GVIPPMVTPMDTNGEVDIQGVEKLVEHLISGGVHGVFILGTTGEFSSLDIAQKKELIAAT 71 Query: 64 LDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIA 123 DGRIPV+ G +I+L++ SG + PYY QE L + +A Sbjct: 72 CKFVDGRIPVLVGVTDVCLKGSIALSKFAERSGAYAVVAAPPYYMGIDQEELCHFYGQLA 131 Query: 124 EHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSD--DF 181 + LP LYN+PS T + +T L+K KNIIG+K+++ N + ++ +D DF Sbjct: 132 DSIPLPLFLYNMPSHTKVSIDVQTAVALSKHKNIIGLKDSSANGSYFQSLRYYFNDQPDF 191 Query: 182 VLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHN 241 VL+ G + + + +GG+G + AN+ R ++ + A E + + +M + Sbjct: 192 VLMVGPEEMLAETVLMGGYGGVCGGANLFPRLYVKLYQAAMAHDIDEIIRLQKLVMTISQ 251 Query: 242 KLF 244 ++ Sbjct: 252 NIY 254 Lambda K H 0.319 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 309 Length adjustment: 27 Effective length of query: 265 Effective length of database: 282 Effective search space: 74730 Effective search space used: 74730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory