Align Diaminopimelate epimerase; DAP epimerase; EC 5.1.1.7; PLP-independent amino acid racemase (uncharacterized)
to candidate Echvi_1430 Echvi_1430 diaminopimelate epimerase
Query= curated2:A6GYX5 (256 letters) >FitnessBrowser__Cola:Echvi_1430 Length = 257 Score = 248 bits (634), Expect = 7e-71 Identities = 130/257 (50%), Positives = 172/257 (66%), Gaps = 5/257 (1%) Query: 1 MKLYKYQGTGNDFIMIDNRLQIFPKQNTALIQKLCDRRFGIGADGLILLENDQSTDFKMV 60 + YKYQGTGNDF+MID+R F ++N L+ +LCDR+FGIGADGLIL+ N + DF+M+ Sbjct: 3 ISFYKYQGTGNDFVMIDDRSAHFDEKNLKLVSQLCDRKFGIGADGLILIRNKEGYDFEMI 62 Query: 61 YYNSDGNQSTMCGNGGRCLVAFAKKLNIIKNKTTFIAIDGLHHATINENDIISLQMKNVE 120 YYN+DG+QS MCGNG RC VAF+ L I+ + F+AIDG H A I + +I +L M +V Sbjct: 63 YYNADGSQS-MCGNGARCAVAFSSFLGIVTEEAHFLAIDGPHDARIEDGNI-ALGMGDVT 120 Query: 121 EVNIHDNYVFLNTGSPHHVQFADNLSNFDVKNEGAKIRYSDLYGQAGSNINFVHQTSPTQ 180 + D+ ++NTGSPHHV+F ++ N+ V + GA IRYSD Y G+N+NFV + Sbjct: 121 AIERVDDDFYVNTGSPHHVRFVKDVENYPVVDTGASIRYSDHYTPKGTNVNFVSTLAEDH 180 Query: 181 FSIRTYERGVEDETLSCGTGATATAIAMKATGKTNSNNITINVQGGKLEVSFNQ-ENSIF 239 +RTYERGVEDETLSCGTG TA A+ + ++I I GG L V F + F Sbjct: 181 IYVRTYERGVEDETLSCGTGVTACALIY--GDQKGIDHIKIKALGGNLAVKFKALPDGRF 238 Query: 240 TNIFLKGPAEFVFETTI 256 TNI L GPA+ VF+ TI Sbjct: 239 TNILLIGPAQQVFKGTI 255 Lambda K H 0.318 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 257 Length adjustment: 24 Effective length of query: 232 Effective length of database: 233 Effective search space: 54056 Effective search space used: 54056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate Echvi_1430 Echvi_1430 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00652.hmm # target sequence database: /tmp/gapView.27721.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00652 [M=270] Accession: TIGR00652 Description: DapF: diaminopimelate epimerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-66 210.6 1.1 1.8e-65 207.0 1.1 1.9 1 lcl|FitnessBrowser__Cola:Echvi_1430 Echvi_1430 diaminopimelate epime Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_1430 Echvi_1430 diaminopimelate epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 207.0 1.1 1.8e-65 1.8e-65 1 268 [. 3 255 .. 3 257 .] 0.91 Alignments for each domain: == domain 1 score: 207.0 bits; conditional E-value: 1.8e-65 TIGR00652 1 meFlkmhGlgNdFvlvdevdeelvkeeaelvrkvcdrhtgvgaDgvllvepsseeadvklrifNsDGSeaemCG 74 ++F+k++G+gNdFv++d++ +++ +++ +lv ++cdr++g+gaDg++l+++ +e +d+++ ++N+DGS+ +mCG lcl|FitnessBrowser__Cola:Echvi_1430 3 ISFYKYQGTGNDFVMIDDRSAHFDEKNLKLVSQLCDRKFGIGADGLILIRN-KEGYDFEMIYYNADGSQ-SMCG 74 58******************88888889**********************6.9***************8.7*** PP TIGR00652 75 NgiRcfakfvyekglkekkelsvetlaglikveveeenkkvkvdmgepkfkkeeipltvekeeekeellalevl 148 Ng+Rc+++f g+++ +e ++ + g + +e+ n + mg ++ e++++++ lcl|FitnessBrowser__Cola:Echvi_1430 75 NGARCAVAFSSFLGIVT-EEAHFLAIDGPHDARIEDGN--IALGMGDVTA----------IERVDDDF------ 129 ****************6.999**************999..9999999921..........12333333...... PP TIGR00652 149 vvdvGnPHlvvfvedvekldleelgklleaheef.pegvNvefvevkkedeiklrvyERG.ageTlaCGtGavA 220 v++G PH v fv+dve+ ++ ++g+ +++++++ p+g+Nv+fv ++ ed+i++r+yERG ++eTl+CGtG +A lcl|FitnessBrowser__Cola:Echvi_1430 130 YVNTGSPHHVRFVKDVENYPVVDTGASIRYSDHYtPKGTNVNFVSTLAEDHIYVRTYERGvEDETLSCGTGVTA 203 59************************************************************************ PP TIGR00652 221 savvalklgktkkkvtvhleggeLeievke..dg...kvyltGpavlvlegel 268 +a++ ++++ + +++++ gg+L +++k dg +++l Gpa++v++g++ lcl|FitnessBrowser__Cola:Echvi_1430 204 CALIYGDQKGID-HIKIKALGGNLAVKFKAlpDGrftNILLIGPAQQVFKGTI 255 ***988887765.69************99743446779************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (257 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 1.88 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory