Align 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; L-2AA aminotransferase; EC 2.6.1.39 (characterized)
to candidate Echvi_3848 Echvi_3848 Ornithine/acetylornithine aminotransferase
Query= SwissProt::Q88FI7 (416 letters) >FitnessBrowser__Cola:Echvi_3848 Length = 381 Score = 184 bits (468), Expect = 3e-51 Identities = 139/402 (34%), Positives = 202/402 (50%), Gaps = 43/402 (10%) Query: 16 ITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPHG 75 +T + +WD G Y+D GG V+++GH +P + I+ Q + Y+ N+ Sbjct: 12 VTPVKASGSTIWDDQGNEYLDLYGGHAVISIGHSHPHYTKRIKEQLDNIAFYS-NSVQIP 70 Query: 76 PYLALMEQLSQFVPVSYPLAGM-LTNSGAEAAENALKVARGATGKRAIIAFDGGFHGRTL 134 L +L Q YP + L NSGAEA ENALK+A TGK+ IAF GFHGRT Sbjct: 71 IQKELATKLGQLS--GYPDYDLFLCNSGAEANENALKLASFETGKKGFIAFTKGFHGRTS 128 Query: 135 ATLNLNGK---VAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVELAVEDV 191 + L +AP+ G V+ LP+ L+A+++ +LA + Sbjct: 129 GAVALTDNPKIIAPFNAHEG-----VHILPFND----------LEAVEK----QLATGTI 169 Query: 192 AAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAFPRL-GI 250 A I E +QG GG DPAF L + G +I+DE+QSG+ R+G+ FA + G+ Sbjct: 170 AGVIVEGIQGVGGIQVPDPAFLLGLSALTKQYGAKLILDEVQSGYARSGKFFAHQWVEGL 229 Query: 251 EPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASLAQMTDEN 310 +PDL+ +AK + G P+G V+ E A+ G LG T+ GN ++CAAALA L + +EN Sbjct: 230 KPDLITVAKGMGNGFPIGGVLISPEFKAS--HGLLGTTFGGNHLACAAALAVLEVIDEEN 287 Query: 311 LATWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEFANADGSPAPAQLAKVMEA 370 L T +AI++ E K +G++ + G G M G + A G P + A + E Sbjct: 288 LITAAAENGKAIMAALE--KVAGVT----EVRGKGLMIGFDLATEAG---PVRAALIHEH 338 Query: 371 ARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCL 412 G S +H IRLL PL IE + L L+ LE L Sbjct: 339 KIFTG-----SAGGKHTIRLLPPLNIEPKALTLFLEKLETVL 375 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 381 Length adjustment: 31 Effective length of query: 385 Effective length of database: 350 Effective search space: 134750 Effective search space used: 134750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory