Align Probable methanogen homoaconitase large subunit; HACN; EC 4.2.1.114; Homoaconitate hydratase (uncharacterized)
to candidate Echvi_2059 Echvi_2059 3-isopropylmalate dehydratase, large subunit
Query= curated2:O27668 (428 letters) >FitnessBrowser__Cola:Echvi_2059 Length = 465 Score = 232 bits (591), Expect = 2e-65 Identities = 144/444 (32%), Positives = 230/444 (51%), Gaps = 58/444 (13%) Query: 30 VDLAMTHDGTSPPTIRTFRDIASRGGPARVWDPERIVMVFDHNVPA--------NTIGAA 81 +D H+ TSP F ++ +RG V PER V DHNVP + + Sbjct: 28 IDKHFIHEVTSPVA---FLNLENRGN--NVLFPERTVATPDHNVPTIDQDKTIKDKLSRM 82 Query: 82 EFQRVTREFAREQGIV--NIFQNAAGICHQVLPERGFVRPGMVIVGADSHTCTYGAFGAF 139 + +++ R+ + GI ++ + GI H + PE G +PGM IV DSHT T+GAFGA Sbjct: 83 QVEKL-RDNCSKYGIELHDLGTDHHGIVHVIGPELGITQPGMTIVCGDSHTSTHGAFGAI 141 Query: 140 ATGMGATDMAMVFATGKTWFMVPEAMRIEVTGEPEGHVYAKDVILHIIGEIGVDGATYRS 199 A G+G +++ MVFA+ P+ MRI V GE V +KD+IL+II +I G T Sbjct: 142 AFGIGTSEVEMVFASQCIMQSKPKRMRITVNGELGKGVTSKDIILYIISKISASGGTGYF 201 Query: 200 VEFTGDTIESMDVSGRMTICNMAVEMGAKNGIMEPNRQTLDYVR----ARTGRE------ 249 +E+ G I+S+ + RMTICNM++EMGA+ G++ P+ T DY++ A G + Sbjct: 202 IEYAGSAIQSLSMEARMTICNMSIEMGARGGLIAPDEVTFDYLKGKEHAPKGEDWDKAVE 261 Query: 250 -FRVYSSDEDSQYLEDHHFDVSDLEPQVACPD---------------------------- 280 ++ +DE +++ ++ +D D+EP + Sbjct: 262 YWKSLRTDEGAEFDLEYTYDAEDIEPMITYGTNPGMGIKIKDIIPTTEGMEGSNKKTYLK 321 Query: 281 --DVDNVYPVHRVEGTHIDEAFLGSCTNGRYEDLKIAAEVIGDRRVHEDVRFIVSPASRE 338 D P ++G ID F+GSCTNGR ED++ AE + ++ +++ + P SRE Sbjct: 322 SLDYMGFQPGEPIKGKKIDYVFVGSCTNGRIEDIRAVAEFVKGKKKADNITAWIVPGSRE 381 Query: 339 IYLKALEDGIIETFIRAGAIVCNPGCGPCLGAHMGVLAPGEVSIATTNRNFRGRMGDPAS 398 + +A+E+G++ AG + PGC CL + + G+ +++T+NRNF GR G P + Sbjct: 382 VESQAIEEGLVSILEEAGFKLRQPGCSACLAMNDDKIPAGKYAVSTSNRNFEGRQG-PGA 440 Query: 399 SVYLANPAVVAESAIEGVISAPQQ 422 LA+P VA AI G ++ P++ Sbjct: 441 RTLLASPLTVAAVAITGEVADPRE 464 Lambda K H 0.320 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 531 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 428 Length of database: 465 Length adjustment: 32 Effective length of query: 396 Effective length of database: 433 Effective search space: 171468 Effective search space used: 171468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory