GapMind for Amino acid biosynthesis

 

Aligments for a candidate for metC in Echinicola vietnamensis KMM 6221, DSM 17526

Align Cystathionine beta-lyase; CBL; Beta-cystathionase; Cysteine lyase; Cysteine-S-conjugate beta-lyase; EC 4.4.1.13 (characterized)
to candidate Echvi_2080 Echvi_2080 Cystathionine beta-lyases/cystathionine gamma-synthases

Query= SwissProt::Q83A83
         (387 letters)



>lcl|FitnessBrowser__Cola:Echvi_2080 Echvi_2080 Cystathionine
           beta-lyases/cystathionine gamma-synthases
          Length = 381

 Score =  419 bits (1077), Expect = e-122
 Identities = 204/376 (54%), Positives = 269/376 (71%), Gaps = 3/376 (0%)

Query: 13  TRVIHAGQKPDPLTGAVMTPIYTASTYAQKSPGVHQGYEYSRSQNPTRFAYERCVADLES 72
           T+VIHAG  PDP TGA+MTPI+  STY QKSPG H+G+EYSR+ NPTR A ++ +A LE+
Sbjct: 5   TKVIHAGVAPDPTTGAIMTPIFQTSTYVQKSPGQHKGFEYSRTHNPTRDALQKSIAALEN 64

Query: 73  GQHGFAFASGMAATATILELLQPGDHVVVMDDVYGGSYRLFENVRKRSAGLSFSFVDFTD 132
           G+HG  F+SGM A   +++LL PGD V+  +D+YGG+YR+F  V  +  G+ F FV   D
Sbjct: 65  GKHGLCFSSGMGAIDALIKLLSPGDEVISTNDLYGGTYRIFTKVFAK-YGIKFHFVSMDD 123

Query: 133 ENKVREAVTAKTKMLWVESPSNPRLKIVDLAKIAEIAKEKNIIAVADNTFATPIIQRPLE 192
              + + +  KT+++W E+P+NP + I+D+  +A IA + +++   DNTFATP +Q PL+
Sbjct: 124 PASIEKYINDKTRLIWAETPTNPMMNIIDIKALAAIAGKHDLLLGVDNTFATPYLQNPLD 183

Query: 193 LGFDIVTHSATKYLNGHSDIIGGVAVVGDNKTLAEQLKYLQNAIGAIAAPFDSFMVLRGL 252
           LG D+V HS TKYL GHSD++ G  VV D++ LAE L ++QN+ GA   P D F+VLRG+
Sbjct: 184 LGADLVMHSVTKYLAGHSDVVMGALVVNDDR-LAEDLAFIQNSCGATPGPQDCFLVLRGI 242

Query: 253 KTLAIRMERHCENAMQLAQWLEKHPKVKRVYYPGLPSHPQHSIAKKQMRYFGGMISVELK 312
           KTL +RMERHC+N   +A +L  HPKV +VY+PG   HP H IA KQMR FGGMIS  + 
Sbjct: 243 KTLHLRMERHCQNGKTIAGYLRHHPKVDKVYWPGFEDHPNHDIAAKQMRDFGGMISFSIV 302

Query: 313 CDLNE-TKKVLERCQLFTLAESLGGVESLIEHPAIMTHASIPQAERQKLGITDGFIRLSV 371
            D  E  KKVLE    F+LAESLGGVESL  HPA MTHASIP+ ER+K+G+TD  IRLSV
Sbjct: 303 GDKQEDAKKVLENLHYFSLAESLGGVESLCGHPASMTHASIPKVEREKVGLTDSLIRLSV 362

Query: 372 GIEAITDLRHDLEAAL 387
           G+E   DL++DL AAL
Sbjct: 363 GVEDAEDLKNDLAAAL 378


Lambda     K      H
   0.319    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 453
Number of extensions: 11
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 387
Length of database: 381
Length adjustment: 30
Effective length of query: 357
Effective length of database: 351
Effective search space:   125307
Effective search space used:   125307
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory