GapMind for Amino acid biosynthesis

 

Aligments for a candidate for metY in Echinicola vietnamensis KMM 6221, DSM 17526

Align O-acetylhomoserine (thiol)-lyase; EC 2.5.1.49 (characterized)
to candidate Echvi_3411 Echvi_3411 OAH/OAS sulfhydrylase

Query= CharProtDB::CH_122447
         (437 letters)



>lcl|FitnessBrowser__Cola:Echvi_3411 Echvi_3411 OAH/OAS
           sulfhydrylase
          Length = 436

 Score =  559 bits (1440), Expect = e-164
 Identities = 281/435 (64%), Positives = 339/435 (77%), Gaps = 11/435 (2%)

Query: 1   MSDPSPKRFETLQLHAGQEPDPATNSRAVPIYATTSYTFNDSAHGARLFGLKEFGNIYSR 60
           MSD + K FETLQLHAG EPD  TNSRAVPIY T+SY FN + HGA LFGLKEFGNIY+R
Sbjct: 1   MSDHNFK-FETLQLHAGHEPDSNTNSRAVPIYQTSSYVFNSAEHGANLFGLKEFGNIYTR 59

Query: 61  IMNPTVDVFEKRIAALEGGVAAVAASSGQAAQFMAISALAHAGDNIVSTSNLYGGTYNQF 120
           IMNPT DVFEKR+AALEGGVAA+A SSGQAAQF+A+S +   GDN V++  LYGGTYNQF
Sbjct: 60  IMNPTNDVFEKRMAALEGGVAALAVSSGQAAQFIALSNILENGDNFVTSPFLYGGTYNQF 119

Query: 121 KVLFPRLGITTKFVQGDKAEDIAAAIDDRTKAVYVETIGNPRYNVPDFEVIAKVAHEKGI 180
           KV F RLGI+ +F   +KAED+   IDDRTKA+YVETIGNP +NVPDFE ++ ++ +  I
Sbjct: 120 KVSFKRLGISARFASSEKAEDMEKLIDDRTKALYVETIGNPGFNVPDFEALSALSKKHDI 179

Query: 181 PLVVDNTFGAGGYFVRPIEHGADIVVHSATKWIGGHGTTIGGVVVDSGKFDWGKNAARFP 240
           PLVVDNTFGAGGY  RP+ HGA IVV SATKWIGGHGT+IGG++VD G ++WG    +FP
Sbjct: 180 PLVVDNTFGAGGYLFRPLAHGAHIVVASATKWIGGHGTSIGGIIVDGGNYNWGN--GKFP 237

Query: 241 QFTQPSEGYHGLNFWETFGP--------IAFAIRVRVEILRDLGSALNPFAAQQLILGLE 292
           QF++PSEGYHGLNFWE FG         IAF+IR RVE LRD G A++PF +  L+ GLE
Sbjct: 238 QFSEPSEGYHGLNFWEVFGEGNPLGLPNIAFSIRARVEGLRDFGPAISPFNSFLLLQGLE 297

Query: 293 TLSLRAERHASNALALANWLKKNDHVSWVSYVGLEEHSSHEVAKKYLKRGFGGVLSFGVK 352
           TLSLRAER   NAL LA WL+ +  V+ VSY GLE H  H +AKKYLK+GFGGVL+F VK
Sbjct: 298 TLSLRAERTVENALTLAKWLENHPQVATVSYPGLESHGHHTLAKKYLKKGFGGVLTFEVK 357

Query: 353 GEAAVGSQVVDNFKLISNLANVGDSKTLAIHPWSTTHEQLTDQERIDSGVTEDAIRISVG 412
           G    G ++VD+ +LIS+LANVGD+KTL I P +TTH+QL+++E+  +GVT   +RIS+G
Sbjct: 358 GGKEAGEKLVDSLQLISHLANVGDAKTLIIQPSATTHQQLSEKEQAAAGVTPGMLRISLG 417

Query: 413 TEHIDDIIADFEQSF 427
            EHIDDI AD EQ+F
Sbjct: 418 IEHIDDICADLEQAF 432


Lambda     K      H
   0.318    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 607
Number of extensions: 23
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 437
Length of database: 436
Length adjustment: 32
Effective length of query: 405
Effective length of database: 404
Effective search space:   163620
Effective search space used:   163620
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory