Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate Echvi_1626 Echvi_1626 branched-chain amino acid aminotransferase, group II
Query= BRENDA::P54691 (305 letters) >FitnessBrowser__Cola:Echvi_1626 Length = 355 Score = 94.4 bits (233), Expect = 4e-24 Identities = 84/274 (30%), Positives = 135/274 (49%), Gaps = 37/274 (13%) Query: 16 PFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHGDRLSKSAKFLHYDIS 75 P+E +S LHYG F GL+ +D TI +FRL RH +R+++S + + Sbjct: 48 PYEQLVLSPLAMCLHYGQTVFEGLKAYRQEDD--TISIFRLARHHERINQSLRRMAMPEI 105 Query: 76 AEKIKEV----IVDFVK---KNQPDKSFYIRPLVYSSG--LGIAPRLHNLEKDFLVYGLE 126 E++ E +VD + + S YIRP V ++ LG++ L F+V Sbjct: 106 PEELFETGIRELVDLEQEWIRGGEGNSLYIRPFVIATEARLGVSISTDYL---FMVVCTP 162 Query: 127 MGDYLAADGVSCRISSWYRQEDRSFP-------LRGKISAAYITSALAKTEAVESGFDEA 179 M Y A + ++ Y R+ P G AAY + LA+ ++GFD+ Sbjct: 163 MAAYYAKP-LKVKVERHYT---RAVPGGVGAAKNGGNYGAAYYPAHLAQ----QAGFDQV 214 Query: 180 ILMNSQGK--VCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRP 237 I +++ V E+ MN+ + +G ++TP + +L G+TRDS+L+IA D+G P +RP Sbjct: 215 IWTDARDHQFVEESGTMNLMFIIDGVLLTPPAGETVLAGVTRDSLLSIARDMGWPVEERP 274 Query: 238 IDKSELMIA------DEVFLSGTAAKITPVKRIE 265 I EL A E F +GTAA + P++ I+ Sbjct: 275 ISLKELEEAFSTGKKVEAFGAGTAAVVAPLELIQ 308 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 355 Length adjustment: 28 Effective length of query: 277 Effective length of database: 327 Effective search space: 90579 Effective search space used: 90579 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory