Align N-acetylglutamylphosphate reductase (EC 1.2.1.38) (characterized)
to candidate RR42_RS01210 RR42_RS01210 n-acetyl-gamma-glutamyl-phosphate reductase
Query= reanno::Korea:Ga0059261_0351 (310 letters) >FitnessBrowser__Cup4G11:RR42_RS01210 Length = 315 Score = 256 bits (655), Expect = 4e-73 Identities = 144/315 (45%), Positives = 186/315 (59%), Gaps = 9/315 (2%) Query: 1 MSVSVFIDGAAGTTGLEIRERLATRSDISLIGLDDAHRKDAGKRAEAINSADFVILCLPD 60 M VF+DG GTTGL + + L+ RSD+ L+ + D RKD +RA +N+AD LCLPD Sbjct: 1 MVFKVFVDGQEGTTGLRLLDYLSGRSDVELLRIADDKRKDPAERARFLNAADVAFLCLPD 60 Query: 61 DAAREAVALIANDTTRVIDASTAHRVADGWTYGFAELEPAQAAAIAEARYVSNPGCWPTG 120 A+REAVAL+ N T VIDASTA R D W YG EL Q I ++ ++ PGC + Sbjct: 61 VASREAVALVTNPDTCVIDASTAFRTTDSWAYGLPELTRGQREKIRTSKRIAVPGCHASA 120 Query: 121 FLALVRPLVRAGLIPPDWVLTAGGASGYSGGGKSMIAEFEDGSEP--TGFRAYGLDLEHK 178 FL VRPLV AG++ D+ ++A +GYSGGGK MIAEFE G P R Y L L HK Sbjct: 121 FLMAVRPLVEAGVMQADYPVSAFSLTGYSGGGKQMIAEFEAGGNPKLDSPRPYSLGLAHK 180 Query: 179 HLPEMQKHARIDHAPIFQPAVARSYRGMLIEVPLPLQMLPRKPAPAQIEQVLADAYRDSP 238 HLPEM+ A + APIF P V +G+ + VP+ L RK P QI + Y Sbjct: 181 HLPEMRVQAGLAQAPIFNPIVGNFLKGLAVTVPVYPDRLARKVTPEQIADLYRKHYEGEQ 240 Query: 239 IVRVLPSDDVS-----LVRIEDDAGTDRLTIRVFGNAERGQARLVATLDNLGKGAGGAAV 293 VRV+P D + ++ T+R+ + VFG+AER L+A LDNLGKGA GAAV Sbjct: 241 FVRVMPVGDEANLDGGFFDVQASNDTNRVDLFVFGSAER--IVLMARLDNLGKGAAGAAV 298 Query: 294 QNLNIMAGFDQTAGL 308 Q +N+ G D+ GL Sbjct: 299 QCMNVHVGADEATGL 313 Lambda K H 0.319 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 315 Length adjustment: 27 Effective length of query: 283 Effective length of database: 288 Effective search space: 81504 Effective search space used: 81504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate RR42_RS01210 RR42_RS01210 (n-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01851 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01851.hmm # target sequence database: /tmp/gapView.20226.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01851 [M=310] Accession: TIGR01851 Description: argC_other: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-144 467.0 0.0 1.7e-144 466.8 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS01210 RR42_RS01210 n-acetyl-gamma-glut Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS01210 RR42_RS01210 n-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 466.8 0.0 1.7e-144 1.7e-144 2 309 .. 3 306 .. 2 307 .. 0.99 Alignments for each domain: == domain 1 score: 466.8 bits; conditional E-value: 1.7e-144 TIGR01851 2 pkvfidGeaGttGlqirerlaerddlellsidedkrkdaderakllnaadvailclpddaareavslvd 70 +kvf+dG++GttGl+++++l++r+d+ell+i++dkrkd++era++lnaadva+lclpd+a+reav+lv+ lcl|FitnessBrowser__Cup4G11:RR42_RS01210 3 FKVFVDGQEGTTGLRLLDYLSGRSDVELLRIADDKRKDPAERARFLNAADVAFLCLPDVASREAVALVT 71 8******************************************************************** PP TIGR01851 71 npntkildastayrtaedwvyGfpelaaeqrekianakrvanPGcyatgaiallrPlveaGilPadfPv 139 np+t+++dasta+rt++ w+yG+pel+ +qreki+ +kr+a+PGc+a+++++ +rPlveaG++ ad+Pv lcl|FitnessBrowser__Cup4G11:RR42_RS01210 72 NPDTCVIDASTAFRTTDSWAYGLPELTRGQREKIRTSKRIAVPGCHASAFLMAVRPLVEAGVMQADYPV 140 ********************************************************************* PP TIGR01851 140 tinavsGysGGGkaliakyeeesaddskkaafiiyglalehkhlpemrkhsglaskPiftPavGdfaqG 208 ++++++GysGGGk++ia++e + +++k ++++y+l l hkhlpemr+++gla+ Pif P vG+f++G lcl|FitnessBrowser__Cup4G11:RR42_RS01210 141 SAFSLTGYSGGGKQMIAEFE--AGGNPKLDSPRPYSLGLAHKHLPEMRVQAGLAQAPIFNPIVGNFLKG 207 ********************..889999***************************************** PP TIGR01851 209 llveiplhlaeldskvsaedihkalaeyykGekfvkvaelddaellddtildaqglngtnrlelfvfgs 277 l+v++p+ + +l+ kv++e+i++ ++y+Ge+fv+v+++ d+ ld +++d+q+ n+tnr++lfvfgs lcl|FitnessBrowser__Cup4G11:RR42_RS01210 208 LAVTVPVYPDRLARKVTPEQIADLYRKHYEGEQFVRVMPVGDEANLDGGFFDVQASNDTNRVDLFVFGS 276 ********************************************************************* PP TIGR01851 278 ddgerallvarldnlGkGasGaavqnlnialG 309 + er++l+arldnlGkGa+Gaavq++n+++G lcl|FitnessBrowser__Cup4G11:RR42_RS01210 277 A--ERIVLMARLDNLGKGAAGAAVQCMNVHVG 306 9..***************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (310 nodes) Target sequences: 1 (315 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.66 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory