Align [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.118; EC 2.6.1.124 (uncharacterized)
to candidate RR42_RS16955 RR42_RS16955 acetylornithine aminotransferase
Query= curated2:Q7SI94 (388 letters) >FitnessBrowser__Cup4G11:RR42_RS16955 Length = 395 Score = 189 bits (480), Expect = 1e-52 Identities = 120/363 (33%), Positives = 195/363 (53%), Gaps = 16/363 (4%) Query: 17 KGEGQYVWDEKNNKYLDMHAGHGVAFLGHRNKVIIDHLKKQMEEISTLSLAFDTPIREEM 76 +G+G ++ D +YLD G V LGH N+ +ID L Q +++ S AF E M Sbjct: 24 EGKGSWLTDHNGKRYLDFVQGWAVNCLGHSNQAMIDALVDQSKKLFNPSPAF---YNEPM 80 Query: 77 IKELDELKPED-LDNLFLLNSGSEAVELALKIARKITKRRK-----IVAFKNSFHGRSMG 130 ++ +L D +F NSG+EA E A+K+ARK ++ K I+ +SFHGR++ Sbjct: 81 LRLARQLTDASCFDKVFFANSGAEANEGAIKLARKWGRKHKNGAFEIITMDHSFHGRTLA 140 Query: 131 ALSVTWNKKYREPFEPLIGPVEFLEYNNVDSLKSITED-TAAVIVEPVQGEGGVIPAKKE 189 +S + + F P + + N++ S++ + D T A+++EPVQGEGGVIPA +E Sbjct: 141 TMSASGKAGWDTIFAPQVPGFPKADLNDLASVEKLINDKTVAIMLEPVQGEGGVIPASRE 200 Query: 190 FVKSLREVTEKVNALLIIDEVQTGFGRTGKIWAYQHFDIKPDILTAGKAIGGGFPVSAVF 249 F++ LR++ ++ L I+DEVQTG GR G ++AY+ ++PDI+T GK IGGG P++A+ Sbjct: 201 FMQGLRKLADQHKLLFIVDEVQTGCGRCGTMFAYELSGVEPDIMTLGKGIGGGVPLAALL 260 Query: 250 LPNWISEKIEEGDHGSTYGGNPLAAAAVTAACKVAKSEKIAEQAQKKGELFMRILKEKLE 309 ++ E GD G TY GNP+ A +A + + Q KG L Sbjct: 261 CKAEVA-SFEAGDQGGTYNGNPVMTAVGSAVISQLTAPGFLQSVQDKGAYLREQLLALTS 319 Query: 310 DFKIVREIRGLGLMIGIDLK--VNPSIA--IKVLQDEKVLSLKAGLTTIRFLPPYLITQS 365 +F + E RG GL+ + L + P + + +Q + +L +RF+P +T Sbjct: 320 EFGLGGE-RGEGLLRALVLNKDIGPQLVEEARDMQPQGLLLNSPRPNLLRFMPALNVTIE 378 Query: 366 DME 368 +++ Sbjct: 379 EID 381 Lambda K H 0.317 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 395 Length adjustment: 31 Effective length of query: 357 Effective length of database: 364 Effective search space: 129948 Effective search space used: 129948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory