Align Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; Asp/Glu-ADT subunit B; EC 6.3.5.- (characterized)
to candidate RR42_RS00605 RR42_RS00605 glutamyl-tRNA amidotransferase
Query= SwissProt::Q9RF06 (475 letters) >FitnessBrowser__Cup4G11:RR42_RS00605 Length = 486 Score = 443 bits (1140), Expect = e-129 Identities = 232/484 (47%), Positives = 325/484 (67%), Gaps = 12/484 (2%) Query: 1 MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAM 60 M +E VIGLE H +L T SK+FS + FGA PN+ + +DLA PGVLPV+N+ AV+ A+ Sbjct: 1 MQWEVVIGLETHTQLSTASKIFSGTSTAFGAAPNTQASPVDLALPGVLPVLNRGAVERAI 60 Query: 61 RAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGET-----KR 115 + +A+ IA S F RKNYFYPD PK YQISQ++ P+ + G I I+V+G+ K Sbjct: 61 QFGLAIGATIAPRSIFARKNYFYPDLPKGYQISQYELPVVQGGSISIQVEGKKGETYEKT 120 Query: 116 IGITRLHMEEDAGKSTHKGEYSL--VDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSI 173 + +TR H+EEDAGKS H+ + +DLNR GTPL+EIV+EPD+RS EA AY + L ++ Sbjct: 121 VQLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSSAEAVAYAKALHAL 180 Query: 174 IQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEE 233 + + G+ D M+EGS RCDAN+S+RPYG K GT+ E+KNLNSF ++++ ++YE + Q Sbjct: 181 VMWLGICDGNMQEGSFRCDANVSVRPYGSPKLGTRREIKNLNSFRFLQQAIDYEVQWQIA 240 Query: 234 ELLSGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIP 293 E+ G EI Q T FD TG+T MR KE + DYRYFP+PD++PL ID AW ERV+ +P Sbjct: 241 EIEDGREIQQATVLFDPDTGETRAMRTKEDAHDYRYFPDPDLLPLEIDAAWIERVKSALP 300 Query: 294 ELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHG--ADVKLTSNWLMGGVNEY 351 ELP +A+ V++ GL AYDA VLT +K ++++FE+ + A+ K +NWLMG V+ Sbjct: 301 ELPVAMQARLVSQYGLSAYDASVLTASKSLANYFEAVVAEAGTANAKPAANWLMGDVSSL 360 Query: 352 LNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKK-VFPELAA--KGGNAKQIMEDNG 408 LN+ + L + P LA ++ I DGT+S+ AKK VFP + A G +A I+ G Sbjct: 361 LNREGIALEAAPVKPAQLAKLLVRIADGTVSNNTAKKDVFPAMWAGEAGADADAIIAAKG 420 Query: 409 LVQISDEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLL 468 L Q+SD L K +++ L N +SVE+++ GK KA LVGQ MKA+KG+ NP VN+LL Sbjct: 421 LKQMSDSGELEKIIDDVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKGNPAQVNELL 480 Query: 469 KQEL 472 K++L Sbjct: 481 KRKL 484 Lambda K H 0.313 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 577 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 475 Length of database: 486 Length adjustment: 34 Effective length of query: 441 Effective length of database: 452 Effective search space: 199332 Effective search space used: 199332 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (24.3 bits)
Align candidate RR42_RS00605 RR42_RS00605 (glutamyl-tRNA amidotransferase)
to HMM TIGR00133 (gatB: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit (EC 6.3.5.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00133.hmm # target sequence database: /tmp/gapView.27604.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00133 [M=481] Accession: TIGR00133 Description: gatB: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-167 541.7 0.0 7.6e-167 541.5 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS00605 RR42_RS00605 glutamyl-tRNA amido Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS00605 RR42_RS00605 glutamyl-tRNA amidotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 541.5 0.0 7.6e-167 7.6e-167 2 480 .. 1 484 [. 1 485 [. 0.97 Alignments for each domain: == domain 1 score: 541.5 bits; conditional E-value: 7.6e-167 TIGR00133 2 ieyelviGlEvHvqlntksKlFckcsneaqeakpNtnvcpvclglPGalPvlNkeavkkAlklalalns 70 +++e+viGlE+H+ql t+sK+F+ +s+ + pNt+ +pv+l+lPG+lPvlN+ av+ A++ +la+++ lcl|FitnessBrowser__Cup4G11:RR42_RS00605 1 MQWEVVIGLETHTQLSTASKIFSGTSTAFGA-APNTQASPVDLALPGVLPVLNRGAVERAIQFGLAIGA 68 5789*************************99.9************************************ PP TIGR00133 71 kivsevsvFdRKhYfYpDlPkgyqitqqdlPiaedGkleieleeke.....keigierlhlEeDtgksq 134 +++ s+F+RK+YfYpDlPkgyqi+q++lP++++G+++i++e+k+ k+++++r hlEeD+gks lcl|FitnessBrowser__Cup4G11:RR42_RS00605 69 T-IAPRSIFARKNYFYPDLPKGYQISQYELPVVQGGSISIQVEGKKgetyeKTVQLTRAHLEEDAGKSL 136 *.668**************************************99999999****************** PP TIGR00133 135 ykesdkdkqslvDfNRsgvPLlEiVtkPdlksakearaflkklrqilryleisdgdleeGsmRvDvNvs 203 ++ + ++ +D+NR+g+PLlEiVt+Pd++s+ ea+a+ k l++++ +l+i dg+++eGs+R+D+Nvs lcl|FitnessBrowser__Cup4G11:RR42_RS00605 137 HED--FAGMTGIDLNRAGTPLLEIVTEPDMRSSAEAVAYAKALHALVMWLGICDGNMQEGSFRCDANVS 203 *94..4789************************************************************ PP TIGR00133 204 irlkGqekegtrvEiKNlnslksiekaieyEieRqkkllkkgeevkqetrafdekksitvslRkKeese 272 +r+ G+ k gtr EiKNlns++ +++ai+yE++ q++++++g+e++q+t fd + t ++R Ke+++ lcl|FitnessBrowser__Cup4G11:RR42_RS00605 204 VRPYGSPKLGTRREIKNLNSFRFLQQAIDYEVQWQIAEIEDGREIQQATVLFDPDTGETRAMRTKEDAH 272 ********************************************************************* PP TIGR00133 273 DYRYfpePdlppieideevvkekveeklpelPeakrirlkkeyglseedakvlvsdlelldafeevvkl 341 DYRYfp+Pdl p+eid ++++ v+ lpelP a+++rl+++ygls++da vl++ ++l+++fe vv lcl|FitnessBrowser__Cup4G11:RR42_RS00605 273 DYRYFPDPDLLPLEIDAAWIER-VKSALPELPVAMQARLVSQYGLSAYDASVLTASKSLANYFEAVVAE 340 *********************9.*******************************************998 PP TIGR00133 342 ikep..klavnWileellgeLnkkkislaeallkpeelaeliklikegkisqksak.elleellen..k 405 ++++ k a+nW++ ++ + Ln++ i l++a +kp +la+l+ i +g++s+ +ak +++ + + lcl|FitnessBrowser__Cup4G11:RR42_RS00605 341 AGTAnaKPAANWLMGDVSSLLNREGIALEAAPVKPAQLAKLLVRIADGTVSNNTAKkDVFPAMWAGeaG 409 87665699*******************************************998862588888755669 PP TIGR00133 406 kdpkklieklgliqisdekelvkiveevikenpkevekyksgkekalkflvGqvmkktkgradpkevek 474 d++++i ++gl q+sd el ki+++v++ n+k+ve++++gkeka++ lvGq+mk tkg+ +p++v++ lcl|FitnessBrowser__Cup4G11:RR42_RS00605 410 ADADAIIAAKGLKQMSDSGELEKIIDDVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKGNPAQVNE 478 9******************************************************************** PP TIGR00133 475 llkell 480 llk +l lcl|FitnessBrowser__Cup4G11:RR42_RS00605 479 LLKRKL 484 ***987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (481 nodes) Target sequences: 1 (486 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 11.10 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory