Align Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Asp/Glu-ADT subunit C; EC 6.3.5.- (uncharacterized)
to candidate RR42_RS00585 RR42_RS00585 glutamyl-tRNA amidotransferase
Query= curated2:B4E7X5 (99 letters) >FitnessBrowser__Cup4G11:RR42_RS00585 Length = 99 Score = 135 bits (340), Expect = 1e-37 Identities = 68/99 (68%), Positives = 80/99 (80%) Query: 1 MALTLTDVKRIAHLARLEMADADAEHMLGQLNEFFGLVEQMQAVDTAGIAPLAHPIEQIQ 60 MAL L+DVKRIAHLAR+E+ D +A L QLN+FF LVEQMQAVDT GI PLAHP+ ++ Sbjct: 1 MALDLSDVKRIAHLARIEINDDEAGQTLVQLNQFFSLVEQMQAVDTTGIVPLAHPLSAVR 60 Query: 61 EVAQRLRDDAVTEVVDRDDNQRPAPAVQDGLYLVPKVIE 99 E++QRLRDD VTE R+D QRPAPA + GLYLVPKVIE Sbjct: 61 EMSQRLRDDVVTEPNRREDYQRPAPATEGGLYLVPKVIE 99 Lambda K H 0.319 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 74 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 99 Length of database: 99 Length adjustment: 10 Effective length of query: 89 Effective length of database: 89 Effective search space: 7921 Effective search space used: 7921 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.9 bits) S2: 39 (19.6 bits)
Align candidate RR42_RS00585 RR42_RS00585 (glutamyl-tRNA amidotransferase)
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))
../bin/blast/fastacmd -i /tmp/list.2082.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.2082.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.