Align L-cysteine desulfidase (EC 4.4.1.28) (characterized)
to candidate RR42_RS21960 RR42_RS21960 cysteine synthase
Query= BRENDA::F4K5T2 (323 letters) >FitnessBrowser__Cup4G11:RR42_RS21960 Length = 305 Score = 251 bits (642), Expect = 1e-71 Identities = 142/303 (46%), Positives = 194/303 (64%), Gaps = 5/303 (1%) Query: 9 NDVTELIGNTPMVYLNKIVDGCVARIAAKLEMMEPCSSIKDRIAYSMIKDAEDKGLITPG 68 +++ + IGNTP + + ++ G ++ K E P SIKDRIA SM++ AE G++ PG Sbjct: 4 DNILQTIGNTPHIRVQRLF-GDTHQVWIKSERANPGGSIKDRIALSMVEAAEQSGVLKPG 62 Query: 69 KSTLIEATGGNTGIGLASIGASRGYKVILLMPSTMSLERRIILRALGAEVHLTDISIGIK 128 T+IE T GNTGIGLA + A +GYK++L+MP +MS+ERR ++ A GA LT G+K Sbjct: 63 -GTIIEPTSGNTGIGLAMVAAVKGYKLVLVMPDSMSVERRRLMLAYGATFDLTPREKGMK 121 Query: 129 GQLEKAKEILSKTPGGYIPHQFINPENPEIHYRTTGPEIWRDSAGKVDILVAGVGTGGTV 188 G + +A+E+++ TPG ++P QF NP N E H TT EI D +D LV GVGTGG + Sbjct: 122 GAIARAEELVAATPGAWMPQQFENPANIEAHVNTTALEILADFPQGIDALVTGVGTGGHI 181 Query: 189 TGTGKFLKEKNKDIKVCVVEPSESAVLSGGKPGPHLIQGIGSGEIPANLDLSIVDEIIQV 248 TG + LK+K +KV VEP S V+SGG P PH IQGIG+G IP NLD +++D +IQV Sbjct: 182 TGCARVLKQKWPALKVYAVEPVASPVISGGAPAPHPIQGIGAGFIPRNLDTALLDGVIQV 241 Query: 249 TGEEAIETTKLLAIKEGLLVGISSGAS-AAAALKVAKRPENVGKLIVVIFPSGGERYLST 307 E A E + A +EG+LVGISSGA+ AA A K+ P G ++ GERYL+ Sbjct: 242 DAEPAREMARRAAREEGMLVGISSGATLAAIAQKLPDLP--AGATVLGFNYDTGERYLTV 299 Query: 308 ELF 310 E F Sbjct: 300 EGF 302 Lambda K H 0.314 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 305 Length adjustment: 27 Effective length of query: 296 Effective length of database: 278 Effective search space: 82288 Effective search space used: 82288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory