Align cysteine synthase (EC 2.5.1.47); L-3-cyanoalanine synthase (EC 4.4.1.9) (characterized)
to candidate RR42_RS21960 RR42_RS21960 cysteine synthase
Query= BRENDA::Q84IF9 (308 letters) >FitnessBrowser__Cup4G11:RR42_RS21960 Length = 305 Score = 318 bits (816), Expect = 8e-92 Identities = 170/296 (57%), Positives = 212/296 (71%), Gaps = 2/296 (0%) Query: 6 NSITELIGDTPAVKLNRIVDEDSADVYLKLEFMNPGSSVKDRIALAMIEAAEKAGKLKPG 65 ++I + IG+TP +++ R+ D+ V++K E NPG S+KDRIAL+M+EAAE++G LKPG Sbjct: 4 DNILQTIGNTPHIRVQRLFG-DTHQVWIKSERANPGGSIKDRIALSMVEAAEQSGVLKPG 62 Query: 66 DTIVEPTSGNTGIGLAMVAAAKGYKAVLVMPDTMSLERRNLLRAYGAELVLTPGAQGMRG 125 TI+EPTSGNTGIGLAMVAA KGYK VLVMPD+MS+ERR L+ AYGA LTP +GM+G Sbjct: 63 GTIIEPTSGNTGIGLAMVAAVKGYKLVLVMPDSMSVERRRLMLAYGATFDLTPREKGMKG 122 Query: 126 PIAKAEELVREH-GYFMPQQFKNEANPEIHRLTTGKEIVEQMGDQLDAFVAGVGTGGTTT 184 IA+AEELV G +MPQQF+N AN E H TT EI+ +DA V GVGTGG T Sbjct: 123 AIARAEELVAATPGAWMPQQFENPANIEAHVNTTALEILADFPQGIDALVTGVGTGGHIT 182 Query: 185 GAGKVLREAYPNIKIYAVEPADSPVLSGGKPGPHKIQGIGAGFVPDILDTSIYDGVITVT 244 G +VL++ +P +K+YAVEP SPV+SGG P PH IQGIGAGF+P LDT++ DGVI V Sbjct: 183 GCARVLKQKWPALKVYAVEPVASPVISGGAPAPHPIQGIGAGFIPRNLDTALLDGVIQVD 242 Query: 245 TEEAFAAARRAAREEGILGGISSGAAIHAALKVAKELGKGKKVLAIIPSNGERYLS 300 E A ARRAAREEG+L GISSGA + A + +L G VL GERYL+ Sbjct: 243 AEPAREMARRAAREEGMLVGISSGATLAAIAQKLPDLPAGATVLGFNYDTGERYLT 298 Lambda K H 0.314 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 305 Length adjustment: 27 Effective length of query: 281 Effective length of database: 278 Effective search space: 78118 Effective search space used: 78118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
Align candidate RR42_RS21960 RR42_RS21960 (cysteine synthase)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.9268.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-122 392.0 0.0 9.6e-122 391.9 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS21960 RR42_RS21960 cysteine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS21960 RR42_RS21960 cysteine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 391.9 0.0 9.6e-122 9.6e-122 2 296 .. 7 300 .. 6 302 .. 0.98 Alignments for each domain: == domain 1 score: 391.9 bits; conditional E-value: 9.6e-122 TIGR01139 2 seliGntPlvrLnlaeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntGi 70 ++iGntP +r+++ + + +v +k e nP++s+kdrial+m+e ae++g+lk+g ti+e+tsGntGi lcl|FitnessBrowser__Cup4G11:RR42_RS21960 7 LQTIGNTPHIRVQRLFGDTHQVWIKSERANPGGSIKDRIALSMVEAAEQSGVLKPGGTIIEPTSGNTGI 75 589****************************************************************** PP TIGR01139 71 alamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkqf 139 +lamvaa +gykl+l+mp++ms+err+l+ ayGa + Lt+ ++gmkgai++aeelv++tp ++ +++qf lcl|FitnessBrowser__Cup4G11:RR42_RS21960 76 GLAMVAAVKGYKLVLVMPDSMSVERRRLMLAYGATFDLTPREKGMKGAIARAEELVAATPGAW-MPQQF 143 ************************************************************999.***** PP TIGR01139 140 enpanpeihrkttapeilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaespvlsggk 208 enpan e+h +tta eil d+ + +da+v+gvGtGG itG ++vlk+k p +kv+aveP++spv+sgg lcl|FitnessBrowser__Cup4G11:RR42_RS21960 144 ENPANIEAHVNTTALEILADFPQGIDALVTGVGTGGHITGCARVLKQKWPALKVYAVEPVASPVISGGA 212 ********************************************************************* PP TIGR01139 209 pgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvakklek 277 p ph iqGigagfiP++Ld+ ++d vi+v+ e a e+arr a+eeG+lvGissGa++aa + +l + lcl|FitnessBrowser__Cup4G11:RR42_RS21960 213 PAPHPIQGIGAGFIPRNLDTALLDGVIQVDAEPAREMARRAAREEGMLVGISSGATLAAIAQKLPDLPA 281 *********************************************************99888888888* PP TIGR01139 278 dkkivvilpdtgerYlsta 296 +++++ dtgerYl+++ lcl|FitnessBrowser__Cup4G11:RR42_RS21960 282 GATVLGFNYDTGERYLTVE 300 ****************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (305 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.37 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory