Align cysteine synthase (EC 2.5.1.47); L-3-cyanoalanine synthase (EC 4.4.1.9) (characterized)
to candidate RR42_RS21960 RR42_RS21960 cysteine synthase
Query= BRENDA::Q84IF9 (308 letters) >FitnessBrowser__Cup4G11:RR42_RS21960 Length = 305 Score = 318 bits (816), Expect = 8e-92 Identities = 170/296 (57%), Positives = 212/296 (71%), Gaps = 2/296 (0%) Query: 6 NSITELIGDTPAVKLNRIVDEDSADVYLKLEFMNPGSSVKDRIALAMIEAAEKAGKLKPG 65 ++I + IG+TP +++ R+ D+ V++K E NPG S+KDRIAL+M+EAAE++G LKPG Sbjct: 4 DNILQTIGNTPHIRVQRLFG-DTHQVWIKSERANPGGSIKDRIALSMVEAAEQSGVLKPG 62 Query: 66 DTIVEPTSGNTGIGLAMVAAAKGYKAVLVMPDTMSLERRNLLRAYGAELVLTPGAQGMRG 125 TI+EPTSGNTGIGLAMVAA KGYK VLVMPD+MS+ERR L+ AYGA LTP +GM+G Sbjct: 63 GTIIEPTSGNTGIGLAMVAAVKGYKLVLVMPDSMSVERRRLMLAYGATFDLTPREKGMKG 122 Query: 126 PIAKAEELVREH-GYFMPQQFKNEANPEIHRLTTGKEIVEQMGDQLDAFVAGVGTGGTTT 184 IA+AEELV G +MPQQF+N AN E H TT EI+ +DA V GVGTGG T Sbjct: 123 AIARAEELVAATPGAWMPQQFENPANIEAHVNTTALEILADFPQGIDALVTGVGTGGHIT 182 Query: 185 GAGKVLREAYPNIKIYAVEPADSPVLSGGKPGPHKIQGIGAGFVPDILDTSIYDGVITVT 244 G +VL++ +P +K+YAVEP SPV+SGG P PH IQGIGAGF+P LDT++ DGVI V Sbjct: 183 GCARVLKQKWPALKVYAVEPVASPVISGGAPAPHPIQGIGAGFIPRNLDTALLDGVIQVD 242 Query: 245 TEEAFAAARRAAREEGILGGISSGAAIHAALKVAKELGKGKKVLAIIPSNGERYLS 300 E A ARRAAREEG+L GISSGA + A + +L G VL GERYL+ Sbjct: 243 AEPAREMARRAAREEGMLVGISSGATLAAIAQKLPDLPAGATVLGFNYDTGERYLT 298 Lambda K H 0.314 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 305 Length adjustment: 27 Effective length of query: 281 Effective length of database: 278 Effective search space: 78118 Effective search space used: 78118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
Align candidate RR42_RS21960 RR42_RS21960 (cysteine synthase)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.8930.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-122 392.0 0.0 9.6e-122 391.9 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS21960 RR42_RS21960 cysteine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS21960 RR42_RS21960 cysteine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 391.9 0.0 9.6e-122 9.6e-122 2 296 .. 7 300 .. 6 302 .. 0.98 Alignments for each domain: == domain 1 score: 391.9 bits; conditional E-value: 9.6e-122 TIGR01139 2 seliGntPlvrLnlaeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntGi 70 ++iGntP +r+++ + + +v +k e nP++s+kdrial+m+e ae++g+lk+g ti+e+tsGntGi lcl|FitnessBrowser__Cup4G11:RR42_RS21960 7 LQTIGNTPHIRVQRLFGDTHQVWIKSERANPGGSIKDRIALSMVEAAEQSGVLKPGGTIIEPTSGNTGI 75 589****************************************************************** PP TIGR01139 71 alamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkqf 139 +lamvaa +gykl+l+mp++ms+err+l+ ayGa + Lt+ ++gmkgai++aeelv++tp ++ +++qf lcl|FitnessBrowser__Cup4G11:RR42_RS21960 76 GLAMVAAVKGYKLVLVMPDSMSVERRRLMLAYGATFDLTPREKGMKGAIARAEELVAATPGAW-MPQQF 143 ************************************************************999.***** PP TIGR01139 140 enpanpeihrkttapeilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaespvlsggk 208 enpan e+h +tta eil d+ + +da+v+gvGtGG itG ++vlk+k p +kv+aveP++spv+sgg lcl|FitnessBrowser__Cup4G11:RR42_RS21960 144 ENPANIEAHVNTTALEILADFPQGIDALVTGVGTGGHITGCARVLKQKWPALKVYAVEPVASPVISGGA 212 ********************************************************************* PP TIGR01139 209 pgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvakklek 277 p ph iqGigagfiP++Ld+ ++d vi+v+ e a e+arr a+eeG+lvGissGa++aa + +l + lcl|FitnessBrowser__Cup4G11:RR42_RS21960 213 PAPHPIQGIGAGFIPRNLDTALLDGVIQVDAEPAREMARRAAREEGMLVGISSGATLAAIAQKLPDLPA 281 *********************************************************99888888888* PP TIGR01139 278 dkkivvilpdtgerYlsta 296 +++++ dtgerYl+++ lcl|FitnessBrowser__Cup4G11:RR42_RS21960 282 GATVLGFNYDTGERYLTVE 300 ****************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (305 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.51 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory