Align Homocysteine/cysteine synthase; O-acetylserine/O-acetylhomoserine sulfhydrylase; OAS-OAH SHLase; OAS-OAH sulfhydrylase; EC 2.5.1.47; EC 2.5.1.49 (characterized)
to candidate RR42_RS32610 RR42_RS32610 O-acetylhomoserine aminocarboxypropyltransferase
Query= SwissProt::P06106 (444 letters) >FitnessBrowser__Cup4G11:RR42_RS32610 Length = 424 Score = 421 bits (1081), Expect = e-122 Identities = 208/429 (48%), Positives = 293/429 (68%), Gaps = 12/429 (2%) Query: 6 DTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSKHGSQLFGLEVPGYVYSRFQNPTSN 65 +T+ +H G D R+ AVPIY T +Y F+N++HG+ LF L+VPG +YSR NPT++ Sbjct: 4 ETIAVHGGYSP--DPTTRAVAVPIYQTVAYAFDNAQHGADLFDLKVPGNIYSRIMNPTND 61 Query: 66 VLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKRF 125 VLE+R+AALEGG ALA++SG AA T AIQ +A GDNI+S S LYGGTYN F + Sbjct: 62 VLEQRLAALEGGVGALALASGMAAITYAIQTIAEAGDNIISASQLYGGTYNLFAHTLPLS 121 Query: 126 GIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNT 185 GIE RF +G NP F + D RTKA+++E++GNP N+ D E I +AH HGIP++VDNT Sbjct: 122 GIETRFADGRNPAAFGDLVDARTKAIFVESVGNPLGNIVDIEAIAKVAHSHGIPLIVDNT 181 Query: 186 FGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAE 245 Y C+P ++GADIV HS TK++GGHG ++GG IVDSGKFPW ++ +F + ++P Sbjct: 182 V-PSPYLCRPFEHGADIVVHSLTKYLGGHGNSVGGAIVDSGKFPWAEHKARFKRLNEPDV 240 Query: 246 GYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLRAERHGENALK 305 YHG +Y EA G AYI R LR+ G ++PF +FL+LQG+ETL+LR +R ENAL Sbjct: 241 SYHGVVYTEALGAAAYIGRARVVPLRNTGAALSPFNAFLILQGIETLALRLDRITENALA 300 Query: 306 LAKWLEQSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLS 365 +A+ L+ SP V WV++ GL H H ++YL G+LSFG+K + +E + Sbjct: 301 VARHLKASPKVEWVNFAGLPEHPDHALVQRYLGGRGPGILSFGLK---SGGRE------A 351 Query: 366 GAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEFID 425 GA+ +D L+L + L N+GDAK+L P TTH+QL+ E A+GV++D++R+S+GIE ID Sbjct: 352 GARFLDALQLFTRLVNIGDAKSLATHPASTTHRQLDAAELKAAGVSEDMVRLSIGIEHID 411 Query: 426 DIIADFQQS 434 D++ D +++ Sbjct: 412 DLLEDLERA 420 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 573 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 424 Length adjustment: 32 Effective length of query: 412 Effective length of database: 392 Effective search space: 161504 Effective search space used: 161504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory