Align asparagine-oxo-acid transaminase (EC 2.6.1.14); alanine-glyoxylate transaminase (EC 2.6.1.44); serine-glyoxylate transaminase (EC 2.6.1.45) (characterized)
to candidate RR42_RS30400 RR42_RS30400 serine--glyoxylate aminotransferase
Query= BRENDA::Q56YA5 (401 letters) >FitnessBrowser__Cup4G11:RR42_RS30400 Length = 406 Score = 365 bits (936), Expect = e-105 Identities = 184/390 (47%), Positives = 253/390 (64%), Gaps = 7/390 (1%) Query: 8 GRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFLFPT 67 GRH L +PGP +P+ ++RAM+ D+R P AL + +L D+KKIFKT ++P Sbjct: 10 GRHFLQIPGPSPVPDRILRAMSYPTIDHRGPEFGALGRKVLADIKKIFKTEQPV-IIYPA 68 Query: 68 TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVE----SDWGQGANL 123 +GTGAWE+ALTNTLSPGD ++ F G F+ LW + L + + W G Sbjct: 69 SGTGAWEAALTNTLSPGDTVLMFETGHFATLWKKMAQALGLKPEFLGLPGVEGWRHGVRA 128 Query: 124 QVLASKLSQDENHTIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICAL 183 ++ ++L D H IKA+C+VHNET+TGVT+D++AVR +D HPALLLVD +S + + Sbjct: 129 DMIEARLRADSAHAIKAVCVVHNETSTGVTSDVAAVRRAIDAAGHPALLLVDTISGLASA 188 Query: 184 DFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKL 243 D+R DEWGVDV ++GSQK L LP G+ SPKA+ A+K +K + F+ W++ ++ K Sbjct: 189 DYRHDEWGVDVTVSGSQKGLMLPPGISFNALSPKAIAASKAAKLPRAFWAWDEIIEANKN 248 Query: 244 GTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEW 303 G YWPYTP+ LLYGL ALD+I EEGL+N+ ARH RL +ATR AV AWGL+ Sbjct: 249 G-YWPYTPNTNLLYGLSEALDMILEEGLDNVFARHQRLAEATRRAVRAWGLEIQCADASM 307 Query: 304 ISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCL 363 S +T VM+P +D E+ +R ++R+++SLG L K+ GK+FRIGHLG+ N+L L+ L Sbjct: 308 YSPVLTGVMMPDGVDADEVRKRIYERFDMSLGQALGKIRGKMFRIGHLGDCNDLTLMATL 367 Query: 364 AGVEMILKDVGYPVVMGSGVAAASTYLQHH 393 +G EM LK G PV SGV AA YL H Sbjct: 368 SGCEMGLKLAGVPVA-ASGVVAAMEYLASH 396 Lambda K H 0.320 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 406 Length adjustment: 31 Effective length of query: 370 Effective length of database: 375 Effective search space: 138750 Effective search space used: 138750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory