Align histidinol dehydrogenase (EC 1.1.1.23) (characterized)
to candidate RR42_RS18915 RR42_RS18915 histidinol dehydrogenase
Query= BRENDA::Q8G2R2 (430 letters) >FitnessBrowser__Cup4G11:RR42_RS18915 Length = 445 Score = 392 bits (1006), Expect = e-113 Identities = 204/432 (47%), Positives = 289/432 (66%), Gaps = 5/432 (1%) Query: 2 VTTLRQTDPDFEQKFAAFLSGKREVSEDVDRAVREIVDRVRREGDSALLDYSRRFDRIDL 61 + L T+ F + L+ + + +DRAV +I+ V+ GD+A+L+Y++RFDR++ Sbjct: 11 IRRLDSTEQGFAAELRKVLAFEAGEDDAIDRAVAQILADVKARGDAAVLEYTQRFDRVEA 70 Query: 62 EK-TGIAVTEAEIDAAFDAAPASTVEALKLARDRIEKHHARQLPKDD----RYTDALGVE 116 + ++ A+++AA + AL+ A R+ +H +Q + YT++ G Sbjct: 71 SSMAALEISPAKLEAALEELEPKRRAALETAAARVRAYHEKQKIECGSHSWEYTESDGTV 130 Query: 117 LGSRWTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAPDGNLNPLVLVAA 176 LG + T ++ VG+YVPGG A+YPSSVLMNA+PA+VAGV ++MVVP P G N LVL AA Sbjct: 131 LGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPARVAGVKEVIMVVPTPGGVRNELVLAAA 190 Query: 177 RLAGVSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIVFGTVGIDMIAGP 236 ++AGV ++ +GGAQA+ ALAYGT ++ V KIVGPGNAYVAAAKR VFGTVGIDMIAGP Sbjct: 191 QIAGVDRVFTIGGAQAVGALAYGTGSLPQVDKIVGPGNAYVAAAKRRVFGTVGIDMIAGP 250 Query: 237 SEVLIVADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAVEEAVERQLHTLARTE 296 SE+L++ D +PDW+A DL +QAEHD AQSIL+ D + VEE++ RQL ++ R + Sbjct: 251 SEILVICDGTTDPDWVAMDLFSQAEHDELAQSILLCPDSNYLAQVEESIHRQLDSMPRRD 310 Query: 297 TASASWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIRNAGSIFIGGYTP 356 AS GA+I V+D ++A +AN IA EHLEI+ + + +IR+AG+IF+G YT Sbjct: 311 VIRASLSGRGALIRVRDMDEACEIANAIAPEHLEISAENPRHWAEKIRHAGAIFLGRYTS 370 Query: 357 EVIGDYVGGCNHVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRALGPAAIEIARAEG 416 E +GDY G NHVLPT+R+ARFSS L V D+ KR+SL+++ + + LG A E+A EG Sbjct: 371 ESLGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIEVSEQGAQMLGQIAAELAYGEG 430 Query: 417 LDAHAQSVAIRL 428 L AHA+S RL Sbjct: 431 LQAHARSAEYRL 442 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 473 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 445 Length adjustment: 32 Effective length of query: 398 Effective length of database: 413 Effective search space: 164374 Effective search space used: 164374 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate RR42_RS18915 RR42_RS18915 (histidinol dehydrogenase)
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.14038.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-166 539.1 0.2 4.4e-166 538.9 0.2 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS18915 RR42_RS18915 histidinol dehydrog Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS18915 RR42_RS18915 histidinol dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 538.9 0.2 4.4e-166 4.4e-166 1 393 [] 43 441 .. 43 441 .. 0.98 Alignments for each domain: == domain 1 score: 538.9 bits; conditional E-value: 4.4e-166 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkv...kleslrvseeeleealeavdeelkealelaaeniekfhek 66 v++i++dv+++Gd+A+leyt++fd+v ++++l++s ++le+ale+++++ ++ale+aa++++++hek lcl|FitnessBrowser__Cup4G11:RR42_RS18915 43 VAQILADVKARGDAAVLEYTQRFDRVeasSMAALEISPAKLEAALEELEPKRRAALETAAARVRAYHEK 111 789***********************666667899********************************** PP TIGR00069 67 qlpes....veveteegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvvtPpkkd 131 q+ e +e+++++g++lgqkv+pl+rvg+YvPgGkaaypS+vlm+a+pA+vAgvke+++v P+ lcl|FitnessBrowser__Cup4G11:RR42_RS18915 112 QKIECgshsWEYTESDGTVLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPARVAGVKEVIMVVPTP-G 179 *95433345*********************************************************6.8 PP TIGR00069 132 gkvnpavlaaakllgvdevykvGGaqaiaalayGtetvpkvdkivGPGniyVtaAKklvfgevgidmia 200 g n+ vlaaa+++gvd+v+++GGaqa++alayGt ++p+vdkivGPGn+yV+aAK+ vfg+vgidmia lcl|FitnessBrowser__Cup4G11:RR42_RS18915 180 GVRNELVLAAAQIAGVDRVFTIGGAQAVGALAYGTGSLPQVDKIVGPGNAYVAAAKRRVFGTVGIDMIA 248 999****************************************************************** PP TIGR00069 201 GPsEvlviadesanpelvaaDllsqaEHdedaqailvttseelaekveeeveeqleelerkeiaeksle 269 GPsE+lvi+d +++p++va+Dl+sqaEHde aq+il++++++ +++vee++++ql++++r++++++sl+ lcl|FitnessBrowser__Cup4G11:RR42_RS18915 249 GPSEILVICDGTTDPDWVAMDLFSQAEHDELAQSILLCPDSNYLAQVEESIHRQLDSMPRRDVIRASLS 317 ********************************************************************* PP TIGR00069 270 kngaiilvddleealelsneyApEHLelqtkdpeellkkiknaGsvflGeytpealgdyvaGpnhvLPT 338 +ga+i v+d++ea+e++n++ApEHLe+ +++p+++++ki++aG++flG+yt+e+lgdy+aGpnhvLPT lcl|FitnessBrowser__Cup4G11:RR42_RS18915 318 GRGALIRVRDMDEACEIANAIAPEHLEISAENPRHWAEKIRHAGAIFLGRYTSESLGDYCAGPNHVLPT 386 ********************************************************************* PP TIGR00069 339 sgtArfasglsvedFlkrisvqelskealeelaeaveklaeaEgLeaHaeavevR 393 s+tArf+s+l+v+dF+kr+s++e+s+++++ l++ +++la EgL+aHa+++e R lcl|FitnessBrowser__Cup4G11:RR42_RS18915 387 SRTARFSSPLGVYDFQKRSSLIEVSEQGAQMLGQIAAELAYGEGLQAHARSAEYR 441 ***************************************************9988 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (445 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.82 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory