Align Ribose-phosphate pyrophosphokinase; RPPK; EC 2.7.6.1; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase (uncharacterized)
to candidate RR42_RS11675 RR42_RS11675 phosphoribosylpyrophosphate synthetase
Query= curated2:Q8TUT6 (291 letters) >FitnessBrowser__Cup4G11:RR42_RS11675 Length = 298 Score = 137 bits (345), Expect = 3e-37 Identities = 100/280 (35%), Positives = 138/280 (49%), Gaps = 7/280 (2%) Query: 11 KLGRRLAEELDAELAPVEEDRFPDGEQIVRVPPELDGTVVVVHSMSPPQDENLVKAIITL 70 + R LA L A+ F DGE VR+ L G ++ DE +V + Sbjct: 13 RAARALASALGADWGSAAIRHFADGESSVRLLSPLQGRQAILFCTLDRPDEKIVPLLWAA 72 Query: 71 DAARENGAEEVIAIVPYMAYSRQDRRFEPGEPVSFRAVARAVSANADALITVD--LHEPG 128 AARE+GA V + PY+AY RQD F PGE V+ R A +S + D L+TVD LH Sbjct: 73 IAARESGASRVGLVAPYLAYMRQDAVFHPGEIVAARHFAALLSRHFDWLVTVDPHLHRIA 132 Query: 129 TL-KYFDVPAENVSAAEELGKYLAERFEGEDLVVIGPDEGARELAREVASICGVEYDHLE 187 TL + +P + V AA + +L R ++GPDE +R+ +VA C L Sbjct: 133 TLDDIYTIPTQCVQAAPAIASWL--RATVNQPFLVGPDEESRQWVNDVARRCQAPAIVLH 190 Query: 188 KKRLSGDEVEIHPKELD-VEGRTVVLVDDMIDTGGTMVEAARALRDQGAGTLYAACTHAL 246 K R + VEI +L+ G T VL+DD++ TG TMV AA LR G HA+ Sbjct: 191 KTRHADRCVEIQAADLNAAAGCTPVLLDDIVATGSTMVAAANLLRRAGLAPPVCVAVHAV 250 Query: 247 LTRNAATRLLASGFEDIIATDTVPNPFEKVSVAPPVAEAV 286 +A L A E I+ DTV + +++A P+AEAV Sbjct: 251 FAGDAFAELRAVAAE-IVTCDTVSHSSNGIALAAPLAEAV 289 Lambda K H 0.314 0.134 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 298 Length adjustment: 26 Effective length of query: 265 Effective length of database: 272 Effective search space: 72080 Effective search space used: 72080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
Align candidate RR42_RS11675 RR42_RS11675 (phosphoribosylpyrophosphate synthetase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.9543.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-55 174.5 0.0 1.6e-55 174.2 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS11675 RR42_RS11675 phosphoribosylpyrop Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS11675 RR42_RS11675 phosphoribosylpyrophosphate synthetase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 174.2 0.0 1.6e-55 1.6e-55 3 298 .. 5 292 .. 4 297 .. 0.91 Alignments for each domain: == domain 1 score: 174.2 bits; conditional E-value: 1.6e-55 TIGR01251 3 ilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmellll 71 +++++ +++ a+++a +lg + g++ +++FadgE +vr+ + ++g++ +++ t +++++ ll + lcl|FitnessBrowser__Cup4G11:RR42_RS11675 5 LFALPGNERAARALASALGADWGSAAIRHFADGESSVRLLSPLQGRQAILF--CTLDRPDEKIVPLLWA 71 5778889999***********************************777777..677789********** PP TIGR01251 72 idalkrasaksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHseqiq...gfFd 137 + a+++++a++v +v+Py++Y Rqd ++++e ++a+ +a ll+ d ++tvd H + i ++++ lcl|FitnessBrowser__Cup4G11:RR42_RS11675 72 AIAARESGASRVGLVAPYLAYMRQDAVFHPGEIVAARHFAALLSRH-FDWLVTVDPHLHRIAtldDIYT 139 **********************************************.**********998853337899 PP TIGR01251 138 vpvenlsaspklieelkkkelknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllg 206 +p + ++a+p ++ +l+++ ++++ +v PD+ + +++++va++ +++ +++K+R+ ++ ve+++ ++ lcl|FitnessBrowser__Cup4G11:RR42_RS11675 140 IPTQCVQAAPAIASWLRAT-VNQPFLVGPDEESRQWVNDVARRCQAPAIVLHKTRH-ADRCVEIQAADL 206 *****************96.999999******************************.6669***99999 PP TIGR01251 207 dv.egkdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilv 274 + +g + v++DDi++Tg T+v+aa+lL+++G +++a+h+vf+gdA l+ + e++ ++t+ + lcl|FitnessBrowser__Cup4G11:RR42_RS11675 207 NAaAGCTPVLLDDIVATGSTMVAAANLLRRAGLAPPVCVAVHAVFAGDAFAELRAV-AAEIVTCDTVSH 274 862799**************************9999999**************876.99********** PP TIGR01251 275 eekklpkvseisvapliaeaiari 298 + i +a +aea++++ lcl|FitnessBrowser__Cup4G11:RR42_RS11675 275 ------SSNGIALAAPLAEAVSAV 292 ......556666666666666554 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (298 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 8.20 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory