Align N-succinyldiaminopimelate-aminotransferase (EC 2.6.1.17) (characterized)
to candidate RR42_RS11930 RR42_RS11930 succinyldiaminopimelate aminotransferase
Query= metacyc::MONOMER-6501 (397 letters) >FitnessBrowser__Cup4G11:RR42_RS11930 Length = 405 Score = 468 bits (1203), Expect = e-136 Identities = 245/404 (60%), Positives = 287/404 (71%), Gaps = 10/404 (2%) Query: 1 MNPRLDALHPYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIAANLAGLS 60 MNPRLD L PYPFEKLR LLAD KP LP I+ IGEPKH P + A++ L GL+ Sbjct: 1 MNPRLDLLQPYPFEKLRVLLADV-KPNGALPAISFGIGEPKHPTPEFIKTALSNALQGLA 59 Query: 61 VYPSTKGEPALRQAISQWLSRRYSIPAPDPESEVLPVLGSREALFAFAQTVIDPSA-GAL 119 YP+T G ALRQ ++ W+ RRY++PA + ++VLPV GSREALFAFAQTV+D S GAL Sbjct: 60 NYPTTAGSDALRQCMAAWIQRRYNLPAVNATTQVLPVTGSREALFAFAQTVVDASQPGAL 119 Query: 120 VVCPNPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSPGNPA 179 V+CPNPFYQIYEGAALLAGATP + N+DPAR+F R+ E W + QLVFVCSPGNP Sbjct: 120 VLCPNPFYQIYEGAALLAGATPVFANSDPARNFAPAFDRIGAETWAKVQLVFVCSPGNPT 179 Query: 180 GNVMSLEEWRTLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRLGRDR----YT 235 G V+SLE+WR LF LSDRHGFVIA+ ECYSEIY E PPLG+L+AA +LGR + Sbjct: 180 GAVLSLEDWRELFALSDRHGFVIASDECYSEIYFKEGEPPLGALEAAHKLGRAEGAHPFE 239 Query: 236 NLVAFSSLSKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAWSMRRM 295 LV FSSLSKRSNVPG+RSGFVAGDAALL +FLLYRTYHG AM+P V AS+AAW+ Sbjct: 240 RLVMFSSLSKRSNVPGLRSGFVAGDAALLKKFLLYRTYHGGAMNPAVQTASVAAWNDEAH 299 Query: 296 CRKT-AQYRAKFEAVLPILQNVLDVRAPQASFYLWAG---TPGSDTAFARELYGRTGVTV 351 R A Y KF V P+L VLDV P A FYLWA T SDT FA L VTV Sbjct: 300 VRNNRAAYARKFAEVTPMLAEVLDVALPDAGFYLWADVSRTGLSDTEFAARLLAEQNVTV 359 Query: 352 LPGSLLAREAHNANPGQGRIRIALVAPLDQCVQAAERIAHFART 395 LPGS LAREA NPG R+R+ALVA ++C++ A RI F ++ Sbjct: 360 LPGSYLAREADGINPGANRVRMALVATPEECLEGARRIVAFCKS 403 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 569 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 405 Length adjustment: 31 Effective length of query: 366 Effective length of database: 374 Effective search space: 136884 Effective search space used: 136884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate RR42_RS11930 RR42_RS11930 (succinyldiaminopimelate aminotransferase)
to HMM TIGR03538 (dapC: succinyldiaminopimelate transaminase (EC 2.6.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03538.hmm # target sequence database: /tmp/gapView.30485.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03538 [M=395] Accession: TIGR03538 Description: DapC_gpp: succinyldiaminopimelate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-184 598.4 0.0 3.2e-184 598.3 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS11930 RR42_RS11930 succinyldiaminopime Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS11930 RR42_RS11930 succinyldiaminopimelate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 598.3 0.0 3.2e-184 3.2e-184 1 395 [] 1 401 [. 1 401 [. 0.98 Alignments for each domain: == domain 1 score: 598.3 bits; conditional E-value: 3.2e-184 TIGR03538 1 mnpnlerlkpyPfeklaellkdvtppadleeialsiGePkhatPafvlealvenleelskyPttkGlpe 69 mnp+l+ l+pyPfekl+ ll+dv+p+ l++i++ iGePkh+tP+f++ al + l++l++yPtt+G+++ lcl|FitnessBrowser__Cup4G11:RR42_RS11930 1 MNPRLDLLQPYPFEKLRVLLADVKPNGALPAISFGIGEPKHPTPEFIKTALSNALQGLANYPTTAGSDA 69 9******************************************************************** PP TIGR03538 70 lreaiaeWlerrfelpagvdperqvlPvnGtrealfafvqavidrae.kalvvlPnPfyqiyeGaalla 137 lr+++a+W++rr++lpa v++ +qvlPv+G+realfaf+q+v+d ++ alv++PnPfyqiyeGaalla lcl|FitnessBrowser__Cup4G11:RR42_RS11930 70 LRQCMAAWIQRRYNLPA-VNATTQVLPVTGSREALFAFAQTVVDASQpGALVLCPNPFYQIYEGAALLA 137 *****************.**************************9997899****************** PP TIGR03538 138 gaepyflnctaengfkpdfdavpeevWkrvqllfvcsPgnPtGavlsleelkklleladkydfiiasde 206 ga+p+f n++++ +f p fd + +e+W++vql+fvcsPgnPtGavlsle++++l++l+d+++f+iasde lcl|FitnessBrowser__Cup4G11:RR42_RS11930 138 GATPVFANSDPARNFAPAFDRIGAETWAKVQLVFVCSPGNPTGAVLSLEDWRELFALSDRHGFVIASDE 206 ********************************************************************* PP TIGR03538 207 cyselyldeaeaPvGlleaaaelGrdd....fkrllvfhslskrsnvPGlrsGfvaGdaellkeflryr 271 cyse+y+ e e+P+G leaa++lGr + f+rl++f+slskrsnvPGlrsGfvaGda+llk+fl yr lcl|FitnessBrowser__Cup4G11:RR42_RS11930 207 CYSEIYFKEGEPPLGALEAAHKLGRAEgahpFERLVMFSSLSKRSNVPGLRSGFVAGDAALLKKFLLYR 275 ***********************996544449************************************* PP TIGR03538 272 tyhGcampiavqlasiaaWedekhvrenralyrekfaavleilgavldlelPdasfylWlkv..pdgdd 338 tyhG am++avq+as+aaW+de+hvr+nra+y++kfa v+ +l++vld+ lPda+fylW+ v + d lcl|FitnessBrowser__Cup4G11:RR42_RS11930 276 TYHGGAMNPAVQTASVAAWNDEAHVRNNRAAYARKFAEVTPMLAEVLDVALPDAGFYLWADVsrTGLSD 344 ************************************************************99544679* PP TIGR03538 339 eafaralyeeenvkvlpGrylsreaegvnPGegrvrlalvaeleecveaaerikkll 395 ++fa +l +e+nv+vlpG+yl+rea+g nPG++rvr+alva eec e+a+ri +++ lcl|FitnessBrowser__Cup4G11:RR42_RS11930 345 TEFAARLLAEQNVTVLPGSYLAREADGINPGANRVRMALVATPEECLEGARRIVAFC 401 *****************************************************9885 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (395 nodes) Target sequences: 1 (405 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.17 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory