GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapF in Cupriavidus basilensis 4G11

Align Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 (characterized)
to candidate RR42_RS01250 RR42_RS01250 diaminopimelate epimerase

Query= SwissProt::P44859
         (274 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS01250 RR42_RS01250
           diaminopimelate epimerase
          Length = 288

 Score =  290 bits (743), Expect = 2e-83
 Identities = 147/281 (52%), Positives = 189/281 (67%), Gaps = 7/281 (2%)

Query: 1   MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60
           +QF+KMHG GNDFVV+DG+ Q +  TP   R LA+RH G+G DQ+L+VE P   ++DF Y
Sbjct: 3   LQFTKMHGAGNDFVVLDGIHQTLNLTPAQWRALASRHFGVGADQILVVEKPTRDDVDFRY 62

Query: 61  RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGE 120
           RIFNADG EV  CGNGARCF RFVT  GLT+K+ + V    G + LT++DD Q+ V+MG 
Sbjct: 63  RIFNADGGEVEHCGNGARCFVRFVTDHGLTDKRSVRVQVMNGVITLTLQDDGQVTVDMGA 122

Query: 121 PIWEPAKIPF-------TANKFEKNYILRTDIQTVLCGAVSMGNPHCVVQVDDIQTANVE 173
           P  EPA++PF        A   +  Y L  + +T    AVSMGNPH V  VD+ +   V 
Sbjct: 123 PELEPARVPFRPEGLPAKAEGRDTLYGLEVNGRTGWISAVSMGNPHAVQVVDNTEAFPVL 182

Query: 174 QLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGL 233
           Q GP++E H  FP RVNAGFMQ++ +  I+LRV+ERGAGET ACG+GACAAV  GI +GL
Sbjct: 183 QDGPIIEHHASFPNRVNAGFMQVVERHTIRLRVFERGAGETLACGTGACAAVVAGIRRGL 242

Query: 234 LNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274
           L++ V V   GG L I W+G G  + MTG AT +++G I L
Sbjct: 243 LDSPVLVHTHGGDLTIAWDGEGESVRMTGPATTVFEGSIDL 283


Lambda     K      H
   0.321    0.139    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 281
Number of extensions: 10
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 274
Length of database: 288
Length adjustment: 26
Effective length of query: 248
Effective length of database: 262
Effective search space:    64976
Effective search space used:    64976
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)

Align candidate RR42_RS01250 RR42_RS01250 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00652.hmm
# target sequence database:        /tmp/gapView.30745.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00652  [M=270]
Accession:   TIGR00652
Description: DapF: diaminopimelate epimerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
    1.6e-93  299.0   0.0    1.8e-93  298.8   0.0    1.0  1  lcl|FitnessBrowser__Cup4G11:RR42_RS01250  RR42_RS01250 diaminopimelate epi


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Cup4G11:RR42_RS01250  RR42_RS01250 diaminopimelate epimerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  298.8   0.0   1.8e-93   1.8e-93       2     268 ..       4     281 ..       3     283 .. 0.93

  Alignments for each domain:
  == domain 1  score: 298.8 bits;  conditional E-value: 1.8e-93
                                 TIGR00652   2 eFlkmhGlgNdFvlvdevdeelvkeeaelvrkvcdrhtgvgaDgvllvep.sseeadvklrifNsDGSe 69 
                                               +F+kmhG+gNdFv++d ++++l  + +++ r++++rh+gvgaD++l+ve+ + ++ d+++rifN+DG e
  lcl|FitnessBrowser__Cup4G11:RR42_RS01250   4 QFTKMHGAGNDFVVLDGIHQTLNLT-PAQWRALASRHFGVGADQILVVEKpTRDDVDFRYRIFNADGGE 71 
                                               8******************888877.9*********************9979999************** PP

                                 TIGR00652  70 aemCGNgiRcfakfvyekglkekkelsvetlaglikveveeenkkvkvdmgepkfkkeeiplt....ve 134
                                               +e CGNg+Rcf++fv+++gl++k++++v++ +g+i++++++++ +v+vdmg p+++++ +p++     +
  lcl|FitnessBrowser__Cup4G11:RR42_RS01250  72 VEHCGNGARCFVRFVTDHGLTDKRSVRVQVMNGVITLTLQDDG-QVTVDMGAPELEPARVPFRpeglPA 139
                                               *******************************************.*******************655433 PP

                                 TIGR00652 135 keeekeellalev.....l..vvdvGnPHlvvfvedvekldleelgklleaheefpegvNvefvevkke 196
                                               k+e +++l  lev     +  +v++GnPH+v +v++ e +++ + g+ +e+h +fp++vN  f++v+++
  lcl|FitnessBrowser__Cup4G11:RR42_RS01250 140 KAEGRDTLYGLEVngrtgWisAVSMGNPHAVQVVDNTEAFPVLQDGPIIEHHASFPNRVNAGFMQVVER 208
                                               344444444455577877368************************************************ PP

                                 TIGR00652 197 deiklrvyERGageTlaCGtGavAsavvalklgktkkkvtvhleggeLeievkedg.kvyltGpavlvl 264
                                               ++i+lrv+ERGageTlaCGtGa+A++v++++ g++++ v vh++gg+L+i +  +g +v +tGpa++v+
  lcl|FitnessBrowser__Cup4G11:RR42_RS01250 209 HTIRLRVFERGAGETLACGTGACAAVVAGIRRGLLDSPVLVHTHGGDLTIAWDGEGeSVRMTGPATTVF 277
                                               ********************************************************99*********** PP

                                 TIGR00652 265 egel 268
                                               eg +
  lcl|FitnessBrowser__Cup4G11:RR42_RS01250 278 EGSI 281
                                               *986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (270 nodes)
Target sequences:                          1  (288 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 7.42
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory