Align Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 (characterized)
to candidate RR42_RS01250 RR42_RS01250 diaminopimelate epimerase
Query= SwissProt::P44859 (274 letters) >FitnessBrowser__Cup4G11:RR42_RS01250 Length = 288 Score = 290 bits (743), Expect = 2e-83 Identities = 147/281 (52%), Positives = 189/281 (67%), Gaps = 7/281 (2%) Query: 1 MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHY 60 +QF+KMHG GNDFVV+DG+ Q + TP R LA+RH G+G DQ+L+VE P ++DF Y Sbjct: 3 LQFTKMHGAGNDFVVLDGIHQTLNLTPAQWRALASRHFGVGADQILVVEKPTRDDVDFRY 62 Query: 61 RIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDDNQIRVNMGE 120 RIFNADG EV CGNGARCF RFVT GLT+K+ + V G + LT++DD Q+ V+MG Sbjct: 63 RIFNADGGEVEHCGNGARCFVRFVTDHGLTDKRSVRVQVMNGVITLTLQDDGQVTVDMGA 122 Query: 121 PIWEPAKIPF-------TANKFEKNYILRTDIQTVLCGAVSMGNPHCVVQVDDIQTANVE 173 P EPA++PF A + Y L + +T AVSMGNPH V VD+ + V Sbjct: 123 PELEPARVPFRPEGLPAKAEGRDTLYGLEVNGRTGWISAVSMGNPHAVQVVDNTEAFPVL 182 Query: 174 QLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGACAAVAVGIMQGL 233 Q GP++E H FP RVNAGFMQ++ + I+LRV+ERGAGET ACG+GACAAV GI +GL Sbjct: 183 QDGPIIEHHASFPNRVNAGFMQVVERHTIRLRVFERGAGETLACGTGACAAVVAGIRRGL 242 Query: 234 LNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL 274 L++ V V GG L I W+G G + MTG AT +++G I L Sbjct: 243 LDSPVLVHTHGGDLTIAWDGEGESVRMTGPATTVFEGSIDL 283 Lambda K H 0.321 0.139 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 288 Length adjustment: 26 Effective length of query: 248 Effective length of database: 262 Effective search space: 64976 Effective search space used: 64976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate RR42_RS01250 RR42_RS01250 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00652.hmm # target sequence database: /tmp/gapView.10895.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00652 [M=270] Accession: TIGR00652 Description: DapF: diaminopimelate epimerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-93 299.0 0.0 1.8e-93 298.8 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS01250 RR42_RS01250 diaminopimelate epi Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS01250 RR42_RS01250 diaminopimelate epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 298.8 0.0 1.8e-93 1.8e-93 2 268 .. 4 281 .. 3 283 .. 0.93 Alignments for each domain: == domain 1 score: 298.8 bits; conditional E-value: 1.8e-93 TIGR00652 2 eFlkmhGlgNdFvlvdevdeelvkeeaelvrkvcdrhtgvgaDgvllvep.sseeadvklrifNsDGSe 69 +F+kmhG+gNdFv++d ++++l + +++ r++++rh+gvgaD++l+ve+ + ++ d+++rifN+DG e lcl|FitnessBrowser__Cup4G11:RR42_RS01250 4 QFTKMHGAGNDFVVLDGIHQTLNLT-PAQWRALASRHFGVGADQILVVEKpTRDDVDFRYRIFNADGGE 71 8******************888877.9*********************9979999************** PP TIGR00652 70 aemCGNgiRcfakfvyekglkekkelsvetlaglikveveeenkkvkvdmgepkfkkeeiplt....ve 134 +e CGNg+Rcf++fv+++gl++k++++v++ +g+i++++++++ +v+vdmg p+++++ +p++ + lcl|FitnessBrowser__Cup4G11:RR42_RS01250 72 VEHCGNGARCFVRFVTDHGLTDKRSVRVQVMNGVITLTLQDDG-QVTVDMGAPELEPARVPFRpeglPA 139 *******************************************.*******************655433 PP TIGR00652 135 keeekeellalev.....l..vvdvGnPHlvvfvedvekldleelgklleaheefpegvNvefvevkke 196 k+e +++l lev + +v++GnPH+v +v++ e +++ + g+ +e+h +fp++vN f++v+++ lcl|FitnessBrowser__Cup4G11:RR42_RS01250 140 KAEGRDTLYGLEVngrtgWisAVSMGNPHAVQVVDNTEAFPVLQDGPIIEHHASFPNRVNAGFMQVVER 208 344444444455577877368************************************************ PP TIGR00652 197 deiklrvyERGageTlaCGtGavAsavvalklgktkkkvtvhleggeLeievkedg.kvyltGpavlvl 264 ++i+lrv+ERGageTlaCGtGa+A++v++++ g++++ v vh++gg+L+i + +g +v +tGpa++v+ lcl|FitnessBrowser__Cup4G11:RR42_RS01250 209 HTIRLRVFERGAGETLACGTGACAAVVAGIRRGLLDSPVLVHTHGGDLTIAWDGEGeSVRMTGPATTVF 277 ********************************************************99*********** PP TIGR00652 265 egel 268 eg + lcl|FitnessBrowser__Cup4G11:RR42_RS01250 278 EGSI 281 *986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (288 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.12 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory