Align Aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate RR42_RS04465 RR42_RS04465 aspartate aminotransferase
Query= reanno::BFirm:BPHYT_RS14905 (370 letters) >FitnessBrowser__Cup4G11:RR42_RS04465 Length = 371 Score = 555 bits (1429), Expect = e-163 Identities = 276/363 (76%), Positives = 313/363 (86%) Query: 5 FGPSYVRAIAPYIAGKPISEVAREFGLDEATIVKLASNENPLGMPESAQRAMAQAASELG 64 FGP YVRAI+PY+AGKPISEVAREFGL E+TIVKLASNENPLGMPESA+ A+A A ++LG Sbjct: 8 FGPEYVRAISPYVAGKPISEVAREFGLVESTIVKLASNENPLGMPESARTAIAAAVADLG 67 Query: 65 RYPDANAFELKAALSERYGVPADWVTLGNGSNDILEIAAHAFVEKGQSIVYAQYSFAVYA 124 RYPDAN F LK ALS R+ VP DW+TLGNGSNDILEIAAHA V+ G+SIVYA++SFAVYA Sbjct: 68 RYPDANGFALKGALSARFDVPPDWLTLGNGSNDILEIAAHALVKPGESIVYAEHSFAVYA 127 Query: 125 LATQGLGARAIVVPAVKYGHDLDAMLAAVSDDTRLIFVANPNNPTGTFIEGPKLEAFLDK 184 LATQ +GARAI V A YGHDLDAM A++ DTRL+F+ANPNNPTGTF+ ++E FL K Sbjct: 128 LATQEVGARAIEVKARDYGHDLDAMAVAIAPDTRLVFIANPNNPTGTFLPAAEIETFLAK 187 Query: 185 VPRHVVVVLDEAYTEYLPQEKRYDSIAWVRRYPNLLVSRTFSKAFGLAGLRVGFAIAQPE 244 VP VVVVLDEAY EYL ++YDSIAWVR+YPNLLVSRTFSKA+GLAGLR+G+A+AQP Sbjct: 188 VPADVVVVLDEAYNEYLDDAQQYDSIAWVRKYPNLLVSRTFSKAYGLAGLRIGYAVAQPA 247 Query: 245 LTDLLNRVRQPFNVNTLAQAAAIAALNDKAFLEKSAALNAQGYRRLTEAFDKLGLEYVPS 304 LTDLLNR+RQPFNVN+LAQAAA+AAL D AFL++SA LN G +L AFD+LGL+YVPS Sbjct: 248 LTDLLNRIRQPFNVNSLAQAAAVAALGDAAFLQRSAELNRAGKAQLVAAFDRLGLQYVPS 307 Query: 305 DGNFVLVRVGNDDAAGNRVNLELLKQGVIVRPVGNYGLPQWLRITIGLPEENEAFIAALE 364 GNFVLVRVG DD AG RVNL LLKQGVIVRPVGNY LPQWLRITIGLPEEN AFIAALE Sbjct: 308 SGNFVLVRVGRDDGAGARVNLALLKQGVIVRPVGNYNLPQWLRITIGLPEENAAFIAALE 367 Query: 365 RTL 367 + L Sbjct: 368 KAL 370 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 540 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 371 Length adjustment: 30 Effective length of query: 340 Effective length of database: 341 Effective search space: 115940 Effective search space used: 115940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory