Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate RR42_RS07840 RR42_RS07840 acetylornithine deacetylase
Query= BRENDA::Q92Y75 (374 letters) >FitnessBrowser__Cup4G11:RR42_RS07840 Length = 401 Score = 280 bits (715), Expect = 6e-80 Identities = 149/368 (40%), Positives = 214/368 (58%), Gaps = 11/368 (2%) Query: 9 KLVGFRSVVGLPNNDVVSWIRGYLESHGIAVDVLPGPEGDRSNIFATIGPKEAR---GYI 65 +LV + + N ++ +R + + G+ + P+GD++N+F T+ G + Sbjct: 24 RLVSYDTTSRHSNLGLIEAVRDHFLAKGLRPHLSYNPQGDKANLFVTVPAASGSTDGGIV 83 Query: 66 ISGHMDVVPAAETGWTSDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVPKLAAMPLRRPL 125 +SGH DVVP WT+DPF+ + RLYGRGT DMKGF+ LA +P L LR P+ Sbjct: 84 LSGHTDVVPVDGQNWTTDPFKPVIRDGRLYGRGTCDMKGFIGTSLALLPTLLEARLREPV 143 Query: 126 HLALSYDEEAGCRGVPHMIARLPELCRQPLGAIIGEPTGMRAIRAHKGKAAARLTVRGRS 185 H ALS+DEE GC G P+++A L E P G I+GEPT MR I AHKG A R V+G++ Sbjct: 144 HYALSFDEEIGCMGAPYLLAELRERGVTPGGCIVGEPTSMRVIVAHKGINAYRCCVKGQA 203 Query: 186 GHSSRPDQGLNAIHGVAGVLTQAVAEADRL-VGGPFEHVFEPPYSSLQIGTVKGGQAVNI 244 HSS +G+NAI A ++ AD GP++ F+ P+++ Q GT+ GG A+N Sbjct: 204 AHSSLTPKGVNAIEYAARLICHIRDIADEFKANGPYDRDFDVPFTTAQTGTIHGGIALNT 263 Query: 245 IPDSCEVEFEARAISGVDPAELLAPVRKTAEALTTLGFEVEW-------QELSAYPALSL 297 IP CE FE R + GVDP + A ++ A + E +++A P+L + Sbjct: 264 IPALCEFVFEFRNLPGVDPEAIFARIQGYANDVLLPKMRAEHADAGLTINKIAAAPSLDV 323 Query: 298 EPDAPLAALLEELTGREALPAVSYGTEAGLFQRAGIDAIICGPGDIGRAHKPDEYILIDE 357 A + L+ LT + V+YGTEAGLFQRAGI A++CGPGDI +AHKPDE++ +D+ Sbjct: 324 AEQAAITQLVRALTADRDVNKVAYGTEAGLFQRAGIPAVVCGPGDIEQAHKPDEFVALDQ 383 Query: 358 LMACRAMV 365 L AC A + Sbjct: 384 LAACEAFL 391 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 401 Length adjustment: 30 Effective length of query: 344 Effective length of database: 371 Effective search space: 127624 Effective search space used: 127624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate RR42_RS07840 RR42_RS07840 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.4917.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-118 380.7 0.0 4e-118 380.5 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS07840 RR42_RS07840 acetylornithine dea Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS07840 RR42_RS07840 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 380.5 0.0 4e-118 4e-118 4 365 .] 23 395 .. 20 395 .. 0.96 Alignments for each domain: == domain 1 score: 380.5 bits; conditional E-value: 4e-118 TIGR01892 4 akLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkeg..agglvlsGhtDv 70 ++Lv+ d++s++sn+ lie v+d++ ++g+ + +++g +k nl+ ++ +++g +gg+vlsGhtDv lcl|FitnessBrowser__Cup4G11:RR42_RS07840 23 QRLVSYDTTSRHSNLGLIEAVRDHFLAKGLRPHLSYNPQG-DKANLFVTVPAASGstDGGIVLSGHTDV 90 68**************************************.******999888552279********** PP TIGR01892 71 vPvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGak 139 vPvd+++Wt+Dpf+ +dgrLYgrGt+DmkGF+ + La +p l a+L++P+h +ls+Dee+g++Ga+ lcl|FitnessBrowser__Cup4G11:RR42_RS07840 91 VPVDGQNWTTDPFKPVIRDGRLYGRGTCDMKGFIGTSLALLPTLLEARLREPVHYALSFDEEIGCMGAP 159 ********************************************************************* PP TIGR01892 140 klieala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlva 205 +l++ l p ivGePts++ + ahkG+ + + v+G+ +hss + +Gv+aie aa+l+ ++ + lcl|FitnessBrowser__Cup4G11:RR42_RS07840 160 YLLAELRergVTPGGCIVGEPTSMRVIVAHKGINAYRCCVKGQAAHSSLTPKGVNAIEYAARLICHIRD 228 ***999956666999****************************************************** PP TIGR01892 206 ladklkr.edleeaFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaee.. 271 ad+ k ++++ F++p++t + Gt++GG a n i+a Ce+v+e+R +pG+dpe++ a ++ a++ lcl|FitnessBrowser__Cup4G11:RR42_RS07840 229 IADEFKAnGPYDRDFDVPFTTAQTGTIHGGIALNTIPALCEFVFEFRNLPGVDPEAIFARIQGYANDvl 297 *****99789999*************************************************9999966 PP TIGR01892 272 ...vkekapgfevkveelsatpaleleedaelvalleklaGa.aaevvsygteagllqelGieavvlGP 336 +++++ + + +++ a p+l++ e+a + +l++ l+ + + v+ygteagl+q++Gi+avv+GP lcl|FitnessBrowser__Cup4G11:RR42_RS07840 298 lpkMRAEHADAGLTINKIAAAPSLDVAEQAAITQLVRALTADrDVNKVAYGTEAGLFQRAGIPAVVCGP 366 66667788888999**************************99899************************ PP TIGR01892 337 GdidqahqpdeYveieelkrcrallerlv 365 Gdi+qah+pde+v +++l +c+a+l+++v lcl|FitnessBrowser__Cup4G11:RR42_RS07840 367 GDIEQAHKPDEFVALDQLAACEAFLHKVV 395 *************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (401 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.81 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory