Align Phosphoserine phosphatase SerB1; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate RR42_RS17230 RR42_RS17230 phosphoserine phosphatase
Query= SwissProt::P9WGJ3 (308 letters) >FitnessBrowser__Cup4G11:RR42_RS17230 Length = 224 Score = 83.6 bits (205), Expect = 4e-21 Identities = 71/224 (31%), Positives = 94/224 (41%), Gaps = 14/224 (6%) Query: 59 AFFDVDNTLVQGSSAVHFGRGLAARHYFTYRDVLGFLYAQAKFQLLG--KENSNDVAAGR 116 A FD+D+TL+ S +GR L Y + + G K + D+ A Sbjct: 4 ALFDLDHTLLPTDSDHEWGRFLVRLGVVDEE-----FYRRRNDEFFGHYKAGTLDIQAFL 58 Query: 117 RKALAFIEGRSVAELVALGEEIYDEIIADKIWDGTRELTQMHLDAGQQVWLITATPYELA 176 R ALA + L AL + E+I I R L HLDAG ++TAT + Sbjct: 59 RFALAPLAANPRDRLEALRSQFMREVIDPVITPQARALVYKHLDAGDLCAVVTATNSFVT 118 Query: 177 ATIARRLGLTGALGTVAESV----DGIFTGRLVGEILHGTGKAHAVRSLAIREGLN---L 229 A I G+ + T + DG FTG + G GK V + G Sbjct: 119 APITAAFGIKHLIATEPATANGKPDGAFTGEVAGIPSFREGKIARVEAWLKSMGTQWDAF 178 Query: 230 KRCTAYSDSYNDVPMLSLVGTAVAINPDARLRSLARERGWEIRD 273 + T YSDS ND+P+L V +A NPD RLR A GW I D Sbjct: 179 ENTTFYSDSANDLPLLEKVSEPIAANPDDRLRHHAAASGWRIMD 222 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 224 Length adjustment: 25 Effective length of query: 283 Effective length of database: 199 Effective search space: 56317 Effective search space used: 56317 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory