Align Salicylate synthase; Chorismate mutase; CM; EC 5.4.99.5; Isochorismate synthase/isochorismate lyase; EC 4.2.99.21; EC 5.4.4.2; Mycobactin synthase protein (uncharacterized)
to candidate RR42_RS18295 RR42_RS18295 anthranilate synthase component I
Query= curated2:Q73XV3 (450 letters) >FitnessBrowser__Cup4G11:RR42_RS18295 Length = 505 Score = 142 bits (359), Expect = 2e-38 Identities = 90/264 (34%), Positives = 130/264 (49%), Gaps = 11/264 (4%) Query: 183 DPSNYRDRVASAVAEIAAGRYHKVILSRCLQVPFAVDFPSTYRLARRHNTPVRSFLLRLG 242 + ++Y V A I AG +V + + L P+ + YR R N + G Sbjct: 220 EKADYLAAVHKAKEYIMAGDMMQVQIGQRLVKPYRDSPLTLYRALRSLNPSPYMYFYNFG 279 Query: 243 GIRAVGYSPELVAAV-----------RHDGVVVTEPLAGTRAFGRGALHDRQARDDLESN 291 + VG SPE++ R D +V PLAGTRA G D Q +L ++ Sbjct: 280 DFQIVGASPEILVRQETRRVGSNGDQREDHIVTIRPLAGTRARGNTPEKDAQLATELLND 339 Query: 292 SKEIVEHAISVRSSLQEMAEIAEPGTAVVTDFMTVRERGSVQHLGSTVSGRLGTSNDRMD 351 KEI EH + + + ++ IAE G+ VTD M + + VQH+ S+V G L +D Sbjct: 340 PKEIAEHVMLIDLARNDIGRIAEIGSVKVTDQMVIEKYSHVQHIVSSVEGTLKPGMSNLD 399 Query: 352 ALEALFPAVTASGIPKAGGVEAILRLDEGPRGLYSGAVVMVSADGALDAALTLRAAYEHD 411 L A FPA T SG PK +E I L+ RG+Y GAV +S G +D A+ +R D Sbjct: 400 VLRATFPAGTLSGAPKVHAMEIIDELEPRKRGIYGGAVGYLSFGGEMDLAIAIRTGIVKD 459 Query: 412 GKTWLRAGAGIIEESTPEREFEET 435 G +++A AGI+ +S PE E+ ET Sbjct: 460 GNLYVQAAAGIVADSDPEAEWRET 483 Lambda K H 0.318 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 505 Length adjustment: 33 Effective length of query: 417 Effective length of database: 472 Effective search space: 196824 Effective search space used: 196824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory